Citrus Sinensis ID: 037275


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990--
FSVPSNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARRRRSAHKSSVSQLMDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLLEVQASNSRSCGDERLRTEERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGRMRI
ccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEccccccEEEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEEEccccccccccccccccccccEEcccccccccccHHHHcccccccEEccccccccccccccccccccccEEcccccccccccHHHHcccccccEEEcccccccccccHHHHHcccccEEcccccccEEEccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEccccEEEEcccccccccccccEEEcccccccccccccccccccccEEEccccEEEEcccHHHHcccccccEEccccccccccccccccccccccEEccccccccccHHHHHcccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccEEEcccccEEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHccccccccccEEEEEccccccccEEEEEEEEccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHcHHccccccccEEccccccccccccccEEEccccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHccccccEEccccHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccc
cccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccccEEEEEEccccccEEcccHHHHHcccccEEEccccEEEEEccHHHcccHHcEEEEcccccccccccccHHcccccEEEEEccccccccccHHHcccHcccEEEEEccccccccccccHccHHHHHEEEcccccccccccHHHccccccEEEEEccccccccccHHHHcHHHHHEEEcccccccccccHHHccccccccEEEEEcccccccccccHHcccccEEEEcccccccccccHcHcccccccEEEEcccccccccccccccHHHHccccccEEEEEccccccccccccHcccccccEEEEcccccccccccccHccccccEEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEccccEEEEEccHHHHcccccEEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccHHHHEEEEcccccccccccccEEEccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHccccHHcEEEEccccEEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHEEEccccccccccEEEEEEEcccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEcccccHHHEEEcccccEEEccccccHHcccccccccccccccEEEEEccEcEccccccccccccccccHHHHHHHHHHHHcccccccHHccccccHHHHHHHHcccccHHEccHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccc
fsvpsnetDRLALLAIGsqleddplgvtsswnnstnlcqwtgvtcghrhqrvtkldlsnrtiggtlspyvgnLSFLRYLNladnnfhgeiphqiGRLVRLEALVLAnnsfsgkiptnlsrcsnlISFNARRnnlvgeipaelGYNWLklenltiadnhltghfpasignlstLERINVLGnglwgripnnlgnlRNLILLnlgenrfsgivppsifnisslenvflptnrfngslpldigvslpKLLGFIVAEnnfagsipeslsnasnlveltlfdnqfrGKVSIYFRSLKNLewlnlgsnnlgtgeandLDFLTLLTNCteltaiglddnrfggvlphsIANLSSTMTDIVIAgnqisgiiptGIRNLVNLVELCmddnkltgtiPHAIGELKNLQllyldsnflaggiptslgnlTLLTNLalssndlqgsippslgnckNLIELHMADieltgalppqiLSISTLSLSLDLSynllsgtlplevgnlknLVYFNIsvnrfsgeipvtLSACTSLQQLYLqgnsfsgsipsslsslKSIKEldmssnnlsgqipeyleNLSFLEYLNLSYnhfegevptkgvfsnktgislsgngkvcggldelnlppcpsrglkkrtdFLLKVVVPVTVSGVILSLCLVLFLARRRRSAHKSSVSQLMDQQFPMISYAELSkatndfsssnmigqgsfgfvykgnlgenGMMVAVKVINLkqkgasngfVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIhhhcqppvvhgdlkpsnvllDQDLVAHLGDfglakflssspldtavetpssskgikgtvgyiapeygmggeasmtgdvYSFGILLLEMFtrrrptdgmfnqglTLHEFARTALPDKVMEIVDSVLLLEVqasnsrscgderLRTEERLVAVVETGVVcsmespterMEMRDVVAKLCRARDtflgrmri
fsvpsnetDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRvtkldlsnrtiggtLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNsfsgkiptnlsRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARRRRSAHkssvsqlmdqQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPLDTavetpssskgikgtVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLlevqasnsrscgderlrteERLVAVVETgvvcsmesptermemrdVVAKLCRardtflgrmri
FSVPSNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWgripnnlgnlrnlillnlgenrFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPtslgnltlltnlalssndlQGSIPPSLGNCKNLIELHMADIELTGALPPQIlsistlslsldlsynllsGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNsfsgsipsslsslksikELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARRRRSAHKSSVSQLMDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLLEVQASNSRSCGDERLRTEERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGRMRI
***********ALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGN*****************************IPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARR*******************ISY*************NMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQ******ARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLS****************IKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLLEVQA**********LRTEERLVAVVETGVVCSM*********RDVVAKLCRARDTF******
*SVPSNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLD*********************VVVPVTVSGVILSLCLVLFL*********************MISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQK**SNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSS*************GIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLLEV***********RLRTEERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGRMRI
********DRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARR***********LMDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPL***********GIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLLEVQASNSRSCGDERLRTEERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGRMRI
****SNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARRRRSA*******LMDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPL******PSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLLE***********ERLRTEERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FSVPSNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARRRRSAHKSSVSQLMDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVDSVLLLEVQASNSRSCGDERLRTEERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGRMRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query992 2.2.26 [Sep-21-2011]
C0LGP41010 Probable LRR receptor-lik yes no 0.977 0.960 0.453 0.0
C0LGT61031 LRR receptor-like serine/ no no 0.964 0.928 0.442 0.0
Q9SD621025 Putative receptor-like pr no no 0.975 0.944 0.455 0.0
Q9ZUI0980 Putative leucine-rich rep no no 0.896 0.907 0.359 1e-140
Q9FL281173 LRR receptor-like serine/ no no 0.950 0.803 0.323 1e-138
C0LGQ51249 LRR receptor-like serine/ no no 0.901 0.715 0.332 1e-125
Q8VZG81045 Probable LRR receptor-lik no no 0.877 0.832 0.324 1e-124
Q9SHI21101 Leucine-rich repeat recep no no 0.931 0.839 0.321 1e-122
Q9M2Z11002 Leucine-rich repeat recep no no 0.931 0.922 0.334 1e-122
O493181124 Probable leucine-rich rep no no 0.948 0.837 0.309 1e-121
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1003 (45%), Positives = 652/1003 (65%), Gaps = 33/1003 (3%)

Query: 5    SNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGG 64
            ++ETDR ALL   SQ+ +D   V SSWN+S  LC W GVTCG +++RVT L+L    +GG
Sbjct: 21   TDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGG 80

Query: 65   TLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNL 124
             +SP +GNLSFL  L+L +N F G IP ++G+L RLE L +  N   G IP  L  CS L
Sbjct: 81   VISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRL 140

Query: 125  ISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLW 184
            ++     N L G +P+ELG +   L  L +  N++ G  P S+GNL+ LE++ +  N L 
Sbjct: 141  LNLRLDSNRLGGSVPSELG-SLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLE 199

Query: 185  GRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLP 244
            G IP+++  L  +  L L  N FSG+ PP+++N+SSL+ + +  N F+G L  D+G+ LP
Sbjct: 200  GEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLP 259

Query: 245  KLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNL 304
             LL F +  N F GSIP +LSN S L  L + +N   G +   F ++ NL+ L L +N+L
Sbjct: 260  NLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIPT-FGNVPNLKLLFLHTNSL 318

Query: 305  GTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIP 364
            G+  + DL+FLT LTNCT+L  +G+  NR GG LP SIANLS+ +  + + G  ISG IP
Sbjct: 319  GSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIP 378

Query: 365  TGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNL 424
              I NL+NL +L +D N L+G +P ++G+L NL+ L L SN L+GGIP  +GN+T+L  L
Sbjct: 379  YDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETL 438

Query: 425  ALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTL 484
             LS+N  +G +P SLGNC +L+EL + D +L G +P +I+ I  L L LD+S N L G+L
Sbjct: 439  DLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQL-LRLDMSGNSLIGSL 497

Query: 485  PLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKE 544
            P ++G L+NL   ++  N+ SG++P TL  C +++ L+L+GN F G IP  L  L  +KE
Sbjct: 498  PQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLFYGDIP-DLKGLVGVKE 556

Query: 545  LDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGL 604
            +D+S+N+LSG IPEY  + S LEYLNLS+N+ EG+VP KG+F N T +S+ GN  +CGG+
Sbjct: 557  VDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFENATTVSIVGNNDLCGGI 616

Query: 605  DELNLPPCPSRG---LKKRTDFLLKVVVPVTVSGVILSLCLVLFLAR------RRRSAHK 655
                L PC S+    +KK +  L KVV+ V+V    ++L L+LF+A       R+R  +K
Sbjct: 617  MGFQLKPCLSQAPSVVKKHSSRLKKVVIGVSVG---ITLLLLLFMASVTLIWLRKRKKNK 673

Query: 656  SS---VSQLMDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVI 712
             +       ++     ISY +L  ATN FSSSNM+G GSFG VYK  L     +VAVKV+
Sbjct: 674  ETNNPTPSTLEVLHEKISYGDLRNATNGFSSSNMVGSGSFGTVYKALLLTEKKVVAVKVL 733

Query: 713  NLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWL 772
            N++++GA   F+AEC++L++IRHRNL+K++T CSSIDF+G +F+A++YE+M NGSL+ WL
Sbjct: 734  NMQRRGAMKSFMAECESLKDIRHRNLVKLLTACSSIDFQGNEFRALIYEFMPNGSLDMWL 793

Query: 773  HQSEDQQ---EARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVA 829
            H  E ++    +R+LTL++R+NI IDVAS ++Y+H HC  P+ H DLKPSNVLLD DL A
Sbjct: 794  HPEEVEEIHRPSRTLTLLERLNIAIDVASVLDYLHVHCHEPIAHCDLKPSNVLLDDDLTA 853

Query: 830  HLGDFGLAKFLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLL 889
            H+ DFGLA+ L     ++     SS+ G++GT+GY APEYG+GG+ S+ GDVYSFGILLL
Sbjct: 854  HVSDFGLARLLLKFDEESFFNQLSSA-GVRGTIGYAAPEYGVGGQPSINGDVYSFGILLL 912

Query: 890  EMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVD-SVLLLEVQASNSRSCGDERLRTE 948
            EMFT +RPT+ +F    TL+ + ++ALP+++++IVD S+L + ++               
Sbjct: 913  EMFTGKRPTNELFGGNFTLNSYTKSALPERILDIVDESILHIGLRVG---------FPVV 963

Query: 949  ERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGRMR 991
            E L  V E G+ C  ESP  R+    VV +L   R+ F    R
Sbjct: 964  ECLTMVFEVGLRCCEESPMNRLATSIVVKELISIRERFFKASR 1006





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query992
2241274921022 predicted protein [Populus trichocarpa] 0.985 0.956 0.5 0.0
3594820581040 PREDICTED: probable LRR receptor-like se 0.981 0.936 0.500 0.0
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.981 0.511 0.500 0.0
2240977521025 predicted protein [Populus trichocarpa] 0.987 0.956 0.496 0.0
2555774381028 receptor-kinase, putative [Ricinus commu 0.987 0.953 0.495 0.0
2241190221021 predicted protein [Populus trichocarpa] 0.979 0.952 0.509 0.0
2240811901011 predicted protein [Populus trichocarpa] 0.981 0.963 0.495 0.0
2241419531026 predicted protein [Populus trichocarpa] 0.983 0.951 0.497 0.0
2241191021007 predicted protein [Populus trichocarpa] 0.981 0.967 0.503 0.0
2241131171006 predicted protein [Populus trichocarpa] 0.988 0.975 0.499 0.0
>gi|224127492|ref|XP_002329291.1| predicted protein [Populus trichocarpa] gi|222870745|gb|EEF07876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/998 (50%), Positives = 686/998 (68%), Gaps = 20/998 (2%)

Query: 6    NETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGT 65
            NETD+L+LL   +Q+  DPLG  SSWN S+  CQW+GVTCG RHQRV +LDL +  + G+
Sbjct: 32   NETDKLSLLTFKAQITGDPLGKLSSWNESSQFCQWSGVTCGRRHQRVVELDLHSYQLVGS 91

Query: 66   LSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNLI 125
            LSP++GNLSFLR LNLA+N+    IP ++GRL RLE LVL NN+F G IP N+SRC+NL 
Sbjct: 92   LSPHIGNLSFLRILNLANNSLSLYIPQELGRLFRLEELVLRNNTFDGGIPANISRCANLR 151

Query: 126  SFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWG 185
              +  R NL G++PAELG    KL+ LTI  N+  G  P S GNLS +  I    N L G
Sbjct: 152  ILDFSRGNLTGKLPAELGL-LSKLQVLTIELNNFVGEIPYSFGNLSAINAIYGSINNLEG 210

Query: 186  RIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPK 245
             IPN  G L+ L +L+LG N  SG++PPSIFN+SSL  +  P N+  GSLP  +G++LP 
Sbjct: 211  SIPNVFGQLKRLKILSLGANNLSGMIPPSIFNLSSLTLLSFPVNQLYGSLPHTLGLTLPN 270

Query: 246  LLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLG 305
            L  F +  N F G IP + SNASNL+   +  N F GKV     S  +L+ L +G NNLG
Sbjct: 271  LQVFNIHTNQFGGLIPATFSNASNLLSFQIGSNNFNGKVP-PLSSSHDLQVLGVGDNNLG 329

Query: 306  TGEANDLDFL-TLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIP 364
             GE NDL+F+  L  N T L A+   DN FGGVLP  ++N S+ +  +  A NQI G IP
Sbjct: 330  KGENNDLNFVYPLANNMTSLEALDTSDNNFGGVLPEIVSNFSTKLMKMTFARNQIRGSIP 389

Query: 365  TGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPTSLGNLTLLTNL 424
            T I NL+NL  L ++ N+LTG IP ++G+L+ L  L+L+ N ++G IP+S+GN+T L  +
Sbjct: 390  TQIGNLINLEALGLETNQLTGMIPSSMGKLQKLSDLFLNGNKISGMIPSSMGNMTSLGRV 449

Query: 425  ALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTL 484
             +  N+L+GSIPPSLGN + L+ L ++   L+G +P +++SI +LS+ L LS N L+G+L
Sbjct: 450  NMRLNNLEGSIPPSLGNWQKLLSLALSQNNLSGPIPKELVSIPSLSMYLVLSENELTGSL 509

Query: 485  PLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKE 544
            P+E+  L NL Y ++S NRFSGEIP +L +C SL+ L+L+ N   G IP +LSSL++I+E
Sbjct: 510  PIEMEKLVNLGYLDVSKNRFSGEIPKSLGSCVSLESLHLEENFLQGPIPITLSSLRAIQE 569

Query: 545  LDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGL 604
            L++S NNL+GQIPE+LE+   LE LNLS+N FEGEVP +G F N + IS+ GN K+CGG+
Sbjct: 570  LNLSYNNLTGQIPEFLEDFKLLESLNLSFNDFEGEVPVQGAFQNTSAISIFGNKKLCGGI 629

Query: 605  DELNLPPCPSR---GLKKRTDFLLKVVVPVTVSGVILSLCLVLFLARRRRSAHKSSVSQL 661
             +LNL  CPS      K  T  +  +       GVIL +  +LF   R++    ++    
Sbjct: 630  PQLNLTRCPSSEPTNSKSPTKLIWIIGSVCGFLGVILIISFLLFYCFRKKKDKPAASQPS 689

Query: 662  MDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASN 721
            ++  FP ++Y +L  AT+ FSS+N+IG+GSFG V+KG LG + ++VAVKV+NL +KGAS 
Sbjct: 690  LETSFPRVAYEDLLGATDGFSSANLIGEGSFGSVFKGILGPDKIVVAVKVLNLLRKGASK 749

Query: 722  GFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEA 781
             F+AEC+AL++IRHRNL+K++T CSSIDF+G DF+A+VYE+M NG+LE+WLH  +   EA
Sbjct: 750  SFMAECEALKSIRHRNLVKLLTTCSSIDFQGNDFKALVYEFMVNGNLEEWLHPVQTSDEA 809

Query: 782  ---RSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAK 838
               ++L L+ R+NI I +ASA+ Y+HH CQ P++H DLKPSN+LLD ++ AH+GDFGLA+
Sbjct: 810  NGPKALDLMHRLNIAIHMASALNYLHHDCQMPIIHCDLKPSNILLDTNMTAHVGDFGLAR 869

Query: 839  FLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPT 898
            F S +   T      SS G+KGT+GY APEYG+GG+ S  GDVYS+GILLLEMFT +RP 
Sbjct: 870  FHSEASNQT------SSVGLKGTIGYAAPEYGIGGKVSTYGDVYSYGILLLEMFTGKRPV 923

Query: 899  DGMFNQGLTLHEFARTALPDKVMEIVDSVLLLEVQASNSR-SCGDERLRTEER---LVAV 954
            DGMF  GL LH +A+ ALPD+++E+VD +L+ E+++ NS    G   +   E    L+ +
Sbjct: 924  DGMFKDGLNLHSYAKMALPDRIVEVVDPLLVREIRSVNSSDEMGMYHIGPHEISACLMTI 983

Query: 955  VETGVVCSMESPTERMEMRDVVAKLCRARDTFLG-RMR 991
            ++ GV CS+E P ERM++ DVV +L R +DT LG RMR
Sbjct: 984  IKMGVACSVELPRERMDIGDVVTELNRIKDTLLGTRMR 1021




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482058|ref|XP_002274540.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224097752|ref|XP_002311067.1| predicted protein [Populus trichocarpa] gi|222850887|gb|EEE88434.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255577438|ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis] gi|223530931|gb|EEF32790.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224119022|ref|XP_002331306.1| predicted protein [Populus trichocarpa] gi|222873889|gb|EEF11020.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224081190|ref|XP_002306327.1| predicted protein [Populus trichocarpa] gi|222855776|gb|EEE93323.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224141953|ref|XP_002324325.1| predicted protein [Populus trichocarpa] gi|222865759|gb|EEF02890.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119102|ref|XP_002331325.1| predicted protein [Populus trichocarpa] gi|222873908|gb|EEF11039.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113117|ref|XP_002316396.1| predicted protein [Populus trichocarpa] gi|222865436|gb|EEF02567.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query992
TAIR|locus:20791421010 AT3G47570 [Arabidopsis thalian 0.977 0.960 0.423 2.9e-206
TAIR|locus:20756611025 AT3G47110 [Arabidopsis thalian 0.974 0.943 0.433 1.1e-204
TAIR|locus:20791571011 AT3G47580 [Arabidopsis thalian 0.981 0.963 0.412 4.1e-200
TAIR|locus:20756311009 AT3G47090 [Arabidopsis thalian 0.982 0.966 0.408 1.1e-195
TAIR|locus:21499221031 EFR "EF-TU receptor" [Arabidop 0.962 0.926 0.413 2.5e-193
UNIPROTKB|Q406401025 Xa21 "Receptor kinase-like pro 0.980 0.949 0.400 4.1e-184
UNIPROTKB|O24435813 O24435 "Receptor kinase-like p 0.715 0.873 0.402 6.6e-129
TAIR|locus:2005540999 HAE "HAESA" [Arabidopsis thali 0.889 0.882 0.313 2.1e-113
TAIR|locus:2120412992 BAM3 "BARELY ANY MERISTEM 3" [ 0.859 0.859 0.298 1.7e-109
TAIR|locus:2032553996 HSL1 "HAESA-like 1" [Arabidops 0.877 0.873 0.302 3.9e-108
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1995 (707.3 bits), Expect = 2.9e-206, P = 2.9e-206
 Identities = 425/1003 (42%), Positives = 611/1003 (60%)

Query:     5 SNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGG 64
             ++ETDR ALL   SQ+ +D   V SSWN+S  LC W GVTCG +++RVT L+L    +GG
Sbjct:    21 TDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGG 80

Query:    65 TLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSGKIPTNLSRCSNL 124
              +SP +GNLSFL  L+L +N F G IP ++G+L RLE L +  N   G IP  L  CS L
Sbjct:    81 VISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRL 140

Query:   125 ISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLW 184
             ++     N L G +P+ELG +   L  L +  N++ G  P S+GNL+ LE++ +  N L 
Sbjct:   141 LNLRLDSNRLGGSVPSELG-SLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLE 199

Query:   185 XXXXXXXXXXXXXXXXXXXXXXFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLP 244
                                   FSG+ PP+++N+SSL+ + +  N F+G L  D+G+ LP
Sbjct:   200 GEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLP 259

Query:   245 KLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNL 304
              LL F +  N F GSIP +LSN S L  L + +N   G +   F ++ NL+ L L +N+L
Sbjct:   260 NLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIPT-FGNVPNLKLLFLHTNSL 318

Query:   305 GTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIP 364
             G+  + DL+FLT LTNCT+L  +G+  NR GG LP SIANLS+ +  + + G  ISG IP
Sbjct:   319 GSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIP 378

Query:   365 TGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAGGIPXXXXXXXXXXXX 424
               I NL+NL +L +D N L+G +P ++G+L NL+ L L SN L+GGIP            
Sbjct:   379 YDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETL 438

Query:   425 XXXXXXXQGSIPPSLGNCKNLIELHMADIELTGALPPQIXXXXXXXXXXXXXXXXXXGTL 484
                    +G +P SLGNC +L+EL + D +L G +P +I                  G+L
Sbjct:   439 DLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLI-GSL 497

Query:   485 PLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNXXXXXXXXXXXXXXXXXE 544
             P ++G L+NL   ++  N+ SG++P TL  C +++ L+L+GN                 E
Sbjct:   498 PQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLFYGDIPDLKGLVGVK-E 556

Query:   545 LDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGL 604
             +D+S+N+LSG IPEY  + S LEYLNLS+N+ EG+VP KG+F N T +S+ GN  +CGG+
Sbjct:   557 VDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFENATTVSIVGNNDLCGGI 616

Query:   605 DELNLPPCPSRG---LKKRTDFLLKVVVPVTVSGVILSLCLVLFLAR------RRRSAHK 655
                 L PC S+    +KK +  L KVV+ V+V    ++L L+LF+A       R+R  +K
Sbjct:   617 MGFQLKPCLSQAPSVVKKHSSRLKKVVIGVSVG---ITLLLLLFMASVTLIWLRKRKKNK 673

Query:   656 SS---VSQLMDQQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVI 712
              +       ++     ISY +L  ATN FSSSNM+G GSFG VYK  L     +VAVKV+
Sbjct:   674 ETNNPTPSTLEVLHEKISYGDLRNATNGFSSSNMVGSGSFGTVYKALLLTEKKVVAVKVL 733

Query:   713 NLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWL 772
             N++++GA   F+AEC++L++IRHRNL+K++T CSSIDF+G +F+A++YE+M NGSL+ WL
Sbjct:   734 NMQRRGAMKSFMAECESLKDIRHRNLVKLLTACSSIDFQGNEFRALIYEFMPNGSLDMWL 793

Query:   773 HQSEDQQ---EARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVA 829
             H  E ++    +R+LTL++R+NI IDVAS ++Y+H HC  P+ H DLKPSNVLLD DL A
Sbjct:   794 HPEEVEEIHRPSRTLTLLERLNIAIDVASVLDYLHVHCHEPIAHCDLKPSNVLLDDDLTA 853

Query:   830 HLGDFGLAKFLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLL 889
             H+ DFGLA+ L     ++     SS+ G++GT+GY APEYG+GG+ S+ GDVYSFGILLL
Sbjct:   854 HVSDFGLARLLLKFDEESFFNQLSSA-GVRGTIGYAAPEYGVGGQPSINGDVYSFGILLL 912

Query:   890 EMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEIVD-SVLLLEVQASNSRSCGDERLRTE 948
             EMFT +RPT+ +F    TL+ + ++ALP+++++IVD S+L + ++               
Sbjct:   913 EMFTGKRPTNELFGGNFTLNSYTKSALPERILDIVDESILHIGLRVG---------FPVV 963

Query:   949 ERLVAVVETGVVCSMESPTERMEMRDVVAKLCRARDTFLGRMR 991
             E L  V E G+ C  ESP  R+    VV +L   R+ F    R
Sbjct:   964 ECLTMVFEVGLRCCEESPMNRLATSIVVKELISIRERFFKASR 1006




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2005540 HAE "HAESA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120412 BAM3 "BARELY ANY MERISTEM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032553 HSL1 "HAESA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C0LGP4Y3475_ARATH2, ., 7, ., 1, 1, ., 10.45360.97780.9603yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.110.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-125
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 8e-46
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 7e-42
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-38
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-38
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 6e-38
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-36
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-35
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 7e-35
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 7e-33
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 1e-31
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 8e-30
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 5e-28
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 6e-28
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-27
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 8e-27
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-26
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 3e-26
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 8e-26
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-25
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 8e-25
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-24
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 3e-24
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 7e-24
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 7e-24
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 7e-24
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 5e-23
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 7e-23
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 8e-23
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 2e-22
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 4e-22
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-21
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-21
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 2e-21
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 6e-21
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 9e-21
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 2e-20
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-20
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 3e-20
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 8e-20
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 1e-19
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 1e-19
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 1e-19
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-19
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-19
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-19
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 4e-19
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 7e-19
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-18
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 2e-18
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-18
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 3e-18
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 4e-18
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 5e-18
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 9e-18
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-17
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-17
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-17
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-17
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-17
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-17
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 3e-17
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-17
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 5e-17
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-16
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 2e-16
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-16
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 2e-16
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-16
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 3e-16
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 3e-16
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 3e-16
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 4e-16
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 4e-16
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 5e-16
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 6e-16
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 8e-16
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 8e-16
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 9e-16
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 1e-15
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 1e-15
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-15
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 3e-15
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 3e-15
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 4e-15
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 4e-15
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 5e-15
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 1e-14
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 1e-14
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 2e-14
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-14
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-14
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 2e-14
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 2e-14
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-14
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 2e-14
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 3e-14
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 3e-14
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 3e-14
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 3e-14
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 4e-14
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 4e-14
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 6e-14
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 7e-14
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 9e-14
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 1e-13
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-13
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 1e-13
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 1e-13
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 2e-13
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 3e-13
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 3e-13
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-13
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 3e-13
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 3e-13
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-13
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 4e-13
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 4e-13
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 6e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-13
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 7e-13
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 9e-13
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 9e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 1e-12
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 1e-12
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 1e-12
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 2e-12
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 2e-12
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 3e-12
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 3e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-12
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 5e-12
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 5e-12
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 5e-12
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 5e-12
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 6e-12
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 7e-12
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 8e-12
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 8e-12
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 9e-12
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 9e-12
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 1e-11
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 1e-11
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 1e-11
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 1e-11
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 1e-11
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-11
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 2e-11
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 2e-11
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 2e-11
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 2e-11
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 2e-11
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 2e-11
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-11
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 3e-11
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 3e-11
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 4e-11
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 4e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-11
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 5e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-11
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 6e-11
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 6e-11
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 6e-11
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 7e-11
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 7e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 8e-11
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 8e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-11
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 1e-10
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 1e-10
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 1e-10
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 1e-10
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 1e-10
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-10
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-10
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-10
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 2e-10
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 2e-10
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-10
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-10
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 3e-10
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 3e-10
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 4e-10
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 4e-10
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 4e-10
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 4e-10
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 5e-10
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 5e-10
PHA02882294 PHA02882, PHA02882, putative serine/threonine kina 5e-10
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 6e-10
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 7e-10
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 8e-10
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 8e-10
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 8e-10
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 9e-10
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 9e-10
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 1e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 2e-09
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 2e-09
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 2e-09
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 2e-09
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-09
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-09
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 2e-09
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-09
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-09
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 3e-09
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 3e-09
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-09
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-09
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 4e-09
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 4e-09
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 6e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 7e-09
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 7e-09
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 8e-09
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 8e-09
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 9e-09
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 9e-09
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 9e-09
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 9e-09
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 9e-09
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-08
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 1e-08
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 1e-08
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-08
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-08
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 2e-08
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 2e-08
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 2e-08
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 2e-08
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 2e-08
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 2e-08
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 3e-08
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 4e-08
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 5e-08
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 5e-08
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 6e-08
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 6e-08
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 6e-08
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 7e-08
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 1e-07
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 1e-07
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 1e-07
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 2e-07
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 2e-07
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 2e-07
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 2e-07
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 2e-07
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 2e-07
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 3e-07
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 3e-07
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 4e-07
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 5e-07
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 5e-07
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 6e-07
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 7e-07
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 8e-07
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 9e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 1e-06
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 1e-06
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 2e-06
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 2e-06
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-06
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 2e-06
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 2e-06
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 4e-06
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 4e-06
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 5e-06
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 6e-06
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 6e-06
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 7e-06
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 8e-06
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 9e-06
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-05
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-05
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 1e-05
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 2e-05
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-05
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 3e-05
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 3e-05
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 3e-05
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 4e-05
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 4e-05
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 5e-05
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 5e-05
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 5e-05
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 6e-05
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 6e-05
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 9e-05
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 1e-04
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 2e-04
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 2e-04
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 3e-04
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 3e-04
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 4e-04
COG3642204 COG3642, COG3642, Mn2+-dependent serine/threonine 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 0.001
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphot 0.002
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 0.002
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 0.002
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  405 bits (1042), Expect = e-125
 Identities = 310/1000 (31%), Positives = 483/1000 (48%), Gaps = 118/1000 (11%)

Query: 13  LLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLS----- 67
           LL+  S + +DPL   S+WN+S ++C W G+TC +   RV  +DLS + I G +S     
Sbjct: 34  LLSFKSSI-NDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFR 91

Query: 68  -PYV-------GNLSF------------LRYLNLADNNFHGEIPHQIGRLVRLEALVLAN 107
            PY+         LS             LRYLNL++NNF G IP   G +  LE L L+N
Sbjct: 92  LPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSN 149

Query: 108 NSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASI 167
           N  SG+IP ++   S+L   +   N LVG+IP  L  N   LE LT+A N L G  P  +
Sbjct: 150 NMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLT-NLTSLEFLTLASNQLVGQIPREL 208

Query: 168 GNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLP 227
           G + +L+ I +  N L G IP  +G L +L  L+L  N  +G +P S+ N+ +L+ +FL 
Sbjct: 209 GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLY 268

Query: 228 TNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIY 287
            N+ +G +P  I  SL KL+   +++N+ +G IPE +    NL  L LF N F GK+ + 
Sbjct: 269 QNKLSGPIPPSI-FSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVA 327

Query: 288 FRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSS 347
             SL  L+ L L SN        +L     LT                      + +LS+
Sbjct: 328 LTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLT----------------------VLDLST 365

Query: 348 TMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFL 407
                    N ++G IP G+ +  NL +L +  N L G IP ++G  ++L+ + L  N  
Sbjct: 366 ---------NNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSF 416

Query: 408 AGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSIS 467
           +G +P+    L L+  L +S+N+LQG I     +  +L  L +A  +  G LP      S
Sbjct: 417 SGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPD--SFGS 474

Query: 468 TLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNS 527
               +LDLS N  SG +P ++G+L  L+   +S N+ SGEIP  LS+C  L  L L  N 
Sbjct: 475 KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQ 534

Query: 528 FSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFS 587
            SG IP+S S +  + +LD+S N LSG+IP+ L N+  L  +N+S+NH  G +P+ G F 
Sbjct: 535 LSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFL 594

Query: 588 NKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILSLCLVLFLA 647
                +++GN  +CGG     LPPC  + ++K   +   +   +    V+  +       
Sbjct: 595 AINASAVAGNIDLCGGDTTSGLPPC--KRVRKTPSWWFYITCTLGAFLVLALVAFGFVFI 652

Query: 648 RRRRSAHKSSVSQ---LMDQQFPMISYAELSKATNDFSSS----NMIGQGSFGFVYKGNL 700
           R R +     V       + QF   S    S   ND  SS    N+I +G  G  YKG  
Sbjct: 653 RGRNNLELKRVENEDGTWELQF-FDSKVSKSITINDILSSLKEENVISRGKKGASYKGKS 711

Query: 701 GENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVY 760
            +NGM   VK IN       +  +A+   +  ++H N++K+I +C S   KG     +++
Sbjct: 712 IKNGMQFVVKEIN-DVNSIPSSEIAD---MGKLQHPNIVKLIGLCRS--EKGA---YLIH 762

Query: 761 EYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSN 820
           EY++  +L + L         R+L+  +R  I I +A A+ ++H  C P VV G+L P  
Sbjct: 763 EYIEGKNLSEVL---------RNLSWERRRKIAIGIAKALRFLHCRCSPAVVVGNLSPEK 813

Query: 821 VLLDQDLVAHLGDFGLAKFLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGD 880
           +++D     HL      +      L T  +   SS        Y+APE     + +   D
Sbjct: 814 IIIDGKDEPHL------RLSLPGLLCTDTKCFISS-------AYVAPETRETKDITEKSD 860

Query: 881 VYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDKVMEI-VDSVLLLEVQASNSRS 939
           +Y FG++L+E+ T + P D  F    ++ E+AR    D  +++ +D  +  +V  +    
Sbjct: 861 IYGFGLILIELLTGKSPADAEFGVHGSIVEWARYCYSDCHLDMWIDPSIRGDVSVN---- 916

Query: 940 CGDERLRTEERLVAVVETGVVCSMESPTERMEMRDVVAKL 979
                   +  +V V+   + C+   PT R    DV+  L
Sbjct: 917 --------QNEIVEVMNLALHCTATDPTARPCANDVLKTL 948


Length = 968

>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|226168 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|240159 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 992
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
KOG0589 426 consensus Serine/threonine protein kinase [General 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
PHA02988283 hypothetical protein; Provisional 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
KOG2052513 consensus Activin A type IB receptor, serine/threo 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
PTZ00267 478 NIMA-related protein kinase; Provisional 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
KOG0586 596 consensus Serine/threonine protein kinase [General 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
PHA02882294 putative serine/threonine kinase; Provisional 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.98
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.98
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.98
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.98
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.97
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.97
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.97
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.97
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.97
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.97
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.97
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.97
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.97
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.97
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.97
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.97
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.97
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.97
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.97
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.96
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.96
PLN03224507 probable serine/threonine protein kinase; Provisio 99.96
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.96
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.96
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.96
KOG1152772 consensus Signal transduction serine/threonine kin 99.95
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.95
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.95
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.95
KOG1167418 consensus Serine/threonine protein kinase of the C 99.95
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.95
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.94
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.93
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.91
PLN00181 793 protein SPA1-RELATED; Provisional 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PRK09188365 serine/threonine protein kinase; Provisional 99.89
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.88
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.88
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.88
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.88
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.85
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.83
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.83
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.82
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.81
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.81
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.81
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.78
PRK12274218 serine/threonine protein kinase; Provisional 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
PRK10345210 hypothetical protein; Provisional 99.77
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.75
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.72
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.72
smart00090237 RIO RIO-like kinase. 99.71
PLN03150623 hypothetical protein; Provisional 99.66
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.65
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.65
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.64
PRK14879211 serine/threonine protein kinase; Provisional 99.64
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.62
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.54
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.53
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.53
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.52
PLN03150623 hypothetical protein; Provisional 99.51
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.47
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.44
KOG1266458 consensus Protein kinase [Signal transduction mech 99.42
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.37
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.3
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.28
KOG1243 690 consensus Protein kinase [General function predict 99.24
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.21
COG4248 637 Uncharacterized protein with protein kinase and he 99.19
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.07
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 99.06
KOG3087229 consensus Serine/threonine protein kinase [General 99.0
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.0
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.94
KOG06061205 consensus Microtubule-associated serine/threonine 98.9
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.83
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.81
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.72
COG0478304 RIO-like serine/threonine protein kinase fused to 98.69
PRK09902216 hypothetical protein; Provisional 98.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.5
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.49
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.49
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.46
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.5e-113  Score=1086.53  Aligned_cols=916  Identities=31%  Similarity=0.520  Sum_probs=775.6

Q ss_pred             CHHHHHHHHHHHhhccCCCCCCCCCCcCCCCCCceEeeEEcCCCCeEEEeeccccccCCccCCCCCCCCcCCeeeccCCC
Q 037275            6 NETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNN   85 (992)
Q Consensus         6 ~~~~~~~ll~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~ldl~~~~l~~~l~~~l~~l~~L~~L~L~~n~   85 (992)
                      .++|+.||++||+++ .+|.+.+++|+.+.+||.|.||+|+. ..+|+.|||+++.+.+.+++.+..+++|++|+|++|+
T Consensus        27 ~~~~~~~l~~~~~~~-~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~  104 (968)
T PLN00113         27 HAEELELLLSFKSSI-NDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQ  104 (968)
T ss_pred             CHHHHHHHHHHHHhC-CCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCc
Confidence            678999999999998 47888889998888999999999975 4689999999999999999999999999999999999


Q ss_pred             CCccCCcccc-CCCCCCEEEeecccCCCCCCcccccCCCCcEeecccccccccCChhhcccccccccccccccccCCCCC
Q 037275           86 FHGEIPHQIG-RLVRLEALVLANNSFSGKIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFP  164 (992)
Q Consensus        86 l~~~~p~~~~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~p  164 (992)
                      +.+.+|..+. .+++|++|+|++|++++.+|.  +.+++|++|++++|.+++.+|..+. ++++|++|+|++|.+.+.+|
T Consensus       105 ~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~-~l~~L~~L~L~~n~l~~~~p  181 (968)
T PLN00113        105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIG-SFSSLKVLDLGGNVLVGKIP  181 (968)
T ss_pred             cCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHh-cCCCCCEEECccCcccccCC
Confidence            9999998766 999999999999999988886  5689999999999999999998876 79999999999999999999


Q ss_pred             CccccccccceEEecCCcccCCcCCccCCCCcccEEeccCcccccccCccccccCCCcEEeccCCccCCCCCcccccccc
Q 037275          165 ASIGNLSTLERINVLGNGLWGRIPNNLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLP  244 (992)
Q Consensus       165 ~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~  244 (992)
                      ..++++++|++|++++|.+.+.+|..++++++|++|+|++|++++.+|..+.++++|++|++++|++.+.+|..+ ..++
T Consensus       182 ~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~  260 (968)
T PLN00113        182 NSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLK  260 (968)
T ss_pred             hhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhH-hCCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999998888654 4689


Q ss_pred             ccchhhccccccCCCCchhhhccccCceeeeccccccccccccccccCccceEecCCCCCCCCCCCCchhhhhccCCCcc
Q 037275          245 KLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFRSLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTEL  324 (992)
Q Consensus       245 ~L~~l~l~~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~~~~l~~~~~L  324 (992)
                      +|+.|++++|++.+.+|..+.++++|++|++++|.+.+..|..+.++++|++|++++|.+....+      ..+..+++|
T Consensus       261 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~------~~~~~l~~L  334 (968)
T PLN00113        261 NLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIP------VALTSLPRL  334 (968)
T ss_pred             CCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCC------hhHhcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999876433      346788999


Q ss_pred             eEeecCCCcCCCcCCcccccccccceeEEeeCCccccccCCCccCCCcccEEEccCCcCCCCCCccccCCCCCcEEeccC
Q 037275          325 TAIGLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDS  404 (992)
Q Consensus       325 ~~L~l~~n~l~~~~~~~~~~l~~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~  404 (992)
                      +.|++++|.+.+.+|..+..+. +|+.|++++|++++.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++
T Consensus       335 ~~L~L~~n~l~~~~p~~l~~~~-~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~  413 (968)
T PLN00113        335 QVLQLWSNKFSGEIPKNLGKHN-NLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQD  413 (968)
T ss_pred             CEEECcCCCCcCcCChHHhCCC-CCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcC
Confidence            9999999999999999888774 699999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCCCCCCccccCceeccCCcccCCCCCCccccccccccccccccccccCchhhhhhcccccccccccccccCcc
Q 037275          405 NFLAGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTL  484 (992)
Q Consensus       405 N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~~~~~~~~L~l~~N~l~~~~  484 (992)
                      |++++..|..|..+++|+.|++++|.+++.+|..+..+++|+.|++++|++.+.+|..+.  ...++.|++++|++++..
T Consensus       414 n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~--~~~L~~L~ls~n~l~~~~  491 (968)
T PLN00113        414 NSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG--SKRLENLDLSRNQFSGAV  491 (968)
T ss_pred             CEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccc--cccceEEECcCCccCCcc
Confidence            999999999999999999999999999999999999999999999999999988887653  356778999999999999


Q ss_pred             cccccCCCCccEEeeecccccccCCcccccccccceeeccCCcccccCCccccccCCCCEEECCCcccCCCChhhhhcCC
Q 037275          485 PLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLS  564 (992)
Q Consensus       485 ~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~  564 (992)
                      |..+.++++|++|+|++|++++.+|..+..+++|++|+|++|.+++.+|..|..+++|+.|+|++|++++.+|..+..++
T Consensus       492 ~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~  571 (968)
T PLN00113        492 PRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVE  571 (968)
T ss_pred             ChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcceEecCCCcCcccCCCCCccCCcccccccCCCCcCCCCCCCCCCCCCCCCCCcccceEEEEeeceehhhHHHH-HHHh
Q 037275          565 FLEYLNLSYNHFEGEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLKKRTDFLLKVVVPVTVSGVILS-LCLV  643 (992)
Q Consensus       565 ~L~~L~l~~N~l~~~~~~~~~~~~~~~~~l~~N~~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~v~~~~l~-l~~~  643 (992)
                      +|++|++++|++.|.+|..+.+..+....+.||+..|+.+.....++|.....  .. .++.+++.++++.++++ ++++
T Consensus       572 ~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~~~~c~~~~~--~~-~~~~~~~~~~~~~~~~~~~~~~  648 (968)
T PLN00113        572 SLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCKRVRK--TP-SWWFYITCTLGAFLVLALVAFG  648 (968)
T ss_pred             ccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCccccCCCCCccccc--cc-eeeeehhHHHHHHHHHHHHHHH
Confidence            99999999999999999988888888889999999999765555677854321  11 11122221111112222 2222


Q ss_pred             hhheecccccccccchhh---hc------cCCCcccHHHHHHHhcCCCCCCccccccceEEEEeEECCCCeEEEEEEeec
Q 037275          644 LFLARRRRSAHKSSVSQL---MD------QQFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINL  714 (992)
Q Consensus       644 ~~~~~~~~~~~~~~~~~~---~~------~~~~~~~~~~~~~~~~~~~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~  714 (992)
                      ++++++|+.......+..   ..      .....+++   ......|...++||+|+||.||+|+...+++.||||.++.
T Consensus       649 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~  725 (968)
T PLN00113        649 FVFIRGRNNLELKRVENEDGTWELQFFDSKVSKSITI---NDILSSLKEENVISRGKKGASYKGKSIKNGMQFVVKEIND  725 (968)
T ss_pred             HHHHHhhhcccccccccccccccccccccccchhhhH---HHHHhhCCcccEEccCCCeeEEEEEECCCCcEEEEEEccC
Confidence            333332221111111100   00      00011223   3334567888999999999999999988999999998853


Q ss_pred             cCCCchhHHHHHHHHHHhccCCcceeEEEEeecccccCcceEEEEEEeccCCCHHHHHhhcccchhhcccCHHHHHHHHH
Q 037275          715 KQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIII  794 (992)
Q Consensus       715 ~~~~~~~~~~~E~~~l~~l~h~niv~~~~~~~~~~~~~~~~~~lv~e~~~~gsL~~~l~~~~~~~~~~~l~~~~~~~i~~  794 (992)
                      ...    ...+|++++++++||||++++|+|.+     ....++||||+++|+|.++++         .++|.++.+++.
T Consensus       726 ~~~----~~~~~~~~l~~l~HpnIv~~~~~~~~-----~~~~~lv~Ey~~~g~L~~~l~---------~l~~~~~~~i~~  787 (968)
T PLN00113        726 VNS----IPSSEIADMGKLQHPNIVKLIGLCRS-----EKGAYLIHEYIEGKNLSEVLR---------NLSWERRRKIAI  787 (968)
T ss_pred             Ccc----ccHHHHHHHhhCCCCCcceEEEEEEc-----CCCCEEEEeCCCCCcHHHHHh---------cCCHHHHHHHHH
Confidence            322    12356889999999999999999754     334599999999999999995         278999999999


Q ss_pred             HHHHHHHHHHhcCCCCeEeccCCCCCeeeCCCCcEEEeecccceecCCCCCCCCcccCCCCCcccccccccccccccCCC
Q 037275          795 DVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGE  874 (992)
Q Consensus       795 qi~~~L~~LH~~~~~~ivH~Dlkp~NIll~~~~~~kl~Dfg~a~~~~~~~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~  874 (992)
                      |+|+||+|||..+.++|+|||+||+||+++.++.+++. ||.+.....            .....+++.|+|||++.+..
T Consensus       788 ~ia~~L~yLH~~~~~~iiH~dlkp~Nil~~~~~~~~~~-~~~~~~~~~------------~~~~~~t~~y~aPE~~~~~~  854 (968)
T PLN00113        788 GIAKALRFLHCRCSPAVVVGNLSPEKIIIDGKDEPHLR-LSLPGLLCT------------DTKCFISSAYVAPETRETKD  854 (968)
T ss_pred             HHHHHHHHhccCCCCCeecCCCCHHhEEECCCCceEEE-ecccccccc------------CCCccccccccCcccccCCC
Confidence            99999999996555599999999999999999988875 665443211            11225789999999999999


Q ss_pred             cCcccchhhHHHHHHHHHhCCCCCCCCccCCccHHHHHhhhCChh-HHHHHHhhHhHhhhccCCCCCCccccchHHHHHH
Q 037275          875 ASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPDK-VMEIVDSVLLLEVQASNSRSCGDERLRTEERLVA  953 (992)
Q Consensus       875 ~~~~~DiwSlG~il~elltg~~pf~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  953 (992)
                      ++.++|||||||++|||+||+.||+..........+|.+...... ...++++....            ......++..+
T Consensus       855 ~~~~sDv~S~Gvvl~el~tg~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~  922 (968)
T PLN00113        855 ITEKSDIYGFGLILIELLTGKSPADAEFGVHGSIVEWARYCYSDCHLDMWIDPSIRG------------DVSVNQNEIVE  922 (968)
T ss_pred             CCcccchhhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHhcCccchhheeCccccC------------CCCccHHHHHH
Confidence            999999999999999999999999765444455555555433221 22222221110            11123455677


Q ss_pred             HHHHHhhccCCCCCCCCCHHHHHHHHHHHHHh
Q 037275          954 VVETGVVCSMESPTERMEMRDVVAKLCRARDT  985 (992)
Q Consensus       954 l~~li~~cl~~dP~~RPs~~evl~~L~~~~~~  985 (992)
                      +.+++.+||+.||++||||+||+++|+++.+.
T Consensus       923 ~~~l~~~Cl~~~P~~RPt~~evl~~L~~~~~~  954 (968)
T PLN00113        923 VMNLALHCTATDPTARPCANDVLKTLESASRS  954 (968)
T ss_pred             HHHHHHhhCcCCchhCcCHHHHHHHHHHhhcc
Confidence            89999999999999999999999999988653



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 4e-38
3uim_A326 Structural Basis For The Impact Of Phosphorylation 2e-37
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-32
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-12
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-32
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-12
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 6e-28
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 2e-27
2nry_A307 Crystal Structure Of Irak-4 Length = 307 7e-23
2nru_A307 Crystal Structure Of Irak-4 Length = 307 1e-22
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 2e-22
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 3e-22
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 5e-22
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 5e-22
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 5e-22
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 6e-22
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 8e-22
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 2e-21
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 2e-21
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 3e-21
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 3e-21
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 3e-21
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-21
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 3e-21
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 4e-21
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 4e-21
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 4e-21
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 4e-21
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 5e-21
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 8e-21
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 1e-20
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 1e-20
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 2e-20
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 2e-20
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 6e-18
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 7e-18
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 7e-18
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 7e-18
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 7e-18
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 8e-18
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 8e-18
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 8e-18
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 9e-18
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-17
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-17
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 1e-17
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-17
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 2e-17
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-17
2pl0_A289 Lck Bound To Imatinib Length = 289 2e-17
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-17
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-17
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 2e-17
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 2e-17
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-17
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-17
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 2e-17
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-17
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 2e-17
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-17
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 2e-17
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-17
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-17
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-17
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 3e-17
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 3e-17
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 3e-17
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 3e-17
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 3e-17
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 3e-17
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 3e-17
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 3e-17
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 3e-17
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 3e-17
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 3e-17
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 4e-17
4h58_A275 Braf In Complex With Compound 3 Length = 275 4e-17
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 4e-17
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 4e-17
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 4e-17
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 4e-17
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 4e-17
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 4e-17
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 4e-17
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 4e-17
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 6e-17
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 7e-17
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 7e-17
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 7e-17
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 8e-17
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 9e-17
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 9e-17
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 9e-17
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 9e-17
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 9e-17
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 9e-17
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 9e-17
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 9e-17
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 9e-17
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 9e-17
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 9e-17
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 1e-16
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 1e-16
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 1e-16
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-16
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-16
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-16
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 1e-16
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 1e-16
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 1e-16
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-16
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-16
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-16
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-16
3iok_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 2e-16
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 2e-16
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-16
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 2e-16
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-16
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-16
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-16
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 2e-16
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-16
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-16
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 2e-16
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-16
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 3e-16
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 3e-16
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 3e-16
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 3e-16
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 3e-16
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-16
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 3e-16
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 3e-16
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 3e-16
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 3e-16
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 4e-16
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 4e-16
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 5e-16
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 5e-16
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 5e-16
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 8e-16
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 8e-16
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 8e-16
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 8e-16
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 9e-16
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-15
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 1e-15
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 1e-15
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 1e-15
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-15
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 1e-15
2g15_A318 Structural Characterization Of Autoinhibited C-Met 1e-15
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 1e-15
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 1e-15
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-15
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-15
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-15
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-15
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-15
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-15
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 1e-15
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 2e-15
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 2e-15
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 2e-15
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 3e-15
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 5e-15
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 5e-15
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 7e-15
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 8e-15
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 9e-15
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-14
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 1e-14
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 1e-14
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-14
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 2e-14
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 2e-14
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 3e-14
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 3e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-14
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 3e-14
3a4o_X286 Lyn Kinase Domain Length = 286 3e-14
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 3e-14
3g2f_A336 Crystal Structure Of The Kinase Domain Of Bone Morp 4e-14
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 4e-14
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 4e-14
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 4e-14
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 4e-14
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 5e-14
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 5e-14
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 7e-14
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 7e-14
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 8e-14
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 8e-14
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 8e-14
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 8e-14
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 8e-14
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 8e-14
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 8e-14
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 9e-14
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 1e-13
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 1e-13
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-13
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 1e-13
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 1e-13
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 1e-13
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 1e-13
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 1e-13
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 1e-13
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 1e-13
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-13
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 1e-13
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-13
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 1e-13
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-13
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 1e-13
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 1e-13
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 1e-13
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 1e-13
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-13
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 1e-13
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 1e-13
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 1e-13
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 1e-13
2qlu_A314 Crystal Structure Of Activin Receptor Type Ii Kinas 1e-13
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 1e-13
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 1e-13
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 2e-13
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-13
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-13
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 2e-13
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-13
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 3e-13
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-13
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 3e-13
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 3e-13
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 3e-13
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 3e-13
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 3e-13
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 3e-13
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 4e-13
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 4e-13
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 4e-13
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 4e-13
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 4e-13
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 5e-13
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-13
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 5e-13
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 5e-13
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 6e-13
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 6e-13
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 7e-13
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 7e-13
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 7e-13
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 7e-13
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 9e-13
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 9e-13
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 9e-13
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 9e-13
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-12
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-12
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-12
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-12
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-12
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-12
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-12
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 1e-12
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-12
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-12
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-12
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-12
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 1e-12
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 1e-12
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 1e-12
1fvr_A327 Tie2 Kinase Domain Length = 327 1e-12
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 1e-12
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 1e-12
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-12
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 1e-12
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 1e-12
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-12
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-12
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 2e-12
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 2e-12
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 2e-12
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 2e-12
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 2e-12
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 2e-12
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 2e-12
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-12
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 2e-12
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-12
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 3e-12
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 3e-12
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 3e-12
3lxn_A318 Structural And Thermodynamic Characterization Of Th 3e-12
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 3e-12
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 3e-12
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 3e-12
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 3e-12
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-12
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 4e-12
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 4e-12
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 4e-12
3lxk_A327 Structural And Thermodynamic Characterization Of Th 4e-12
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 4e-12
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 4e-12
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 4e-12
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 5e-12
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 5e-12
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 5e-12
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 6e-12
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 6e-12
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-12
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 7e-12
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 7e-12
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 8e-12
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 9e-12
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 9e-12
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 9e-12
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 1e-11
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 1e-11
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-11
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-11
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-11
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 1e-11
3mdy_A337 Crystal Structure Of The Cytoplasmic Domain Of The 1e-11
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 1e-11
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-11
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 1e-11
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 1e-11
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 1e-11
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 1e-11
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 1e-11
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 1e-11
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-11
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-11
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 2e-11
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 2e-11
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 2e-11
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 2e-11
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 2e-11
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 2e-11
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 2e-11
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 2e-11
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 2e-11
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 2e-11
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 2e-11
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 2e-11
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 2e-11
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 2e-11
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 2e-11
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-11
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 2e-11
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 2e-11
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 2e-11
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 2e-11
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 2e-11
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 2e-11
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 2e-11
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 2e-11
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 2e-11
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 2e-11
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-11
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 2e-11
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 2e-11
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 2e-11
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 2e-11
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 2e-11
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 2e-11
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 2e-11
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 2e-11
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 3e-11
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 3e-11
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 3e-11
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 3e-11
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 3e-11
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 3e-11
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 3e-11
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 3e-11
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 3e-11
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 3e-11
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 4e-11
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 4e-11
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 4e-11
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 4e-11
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 4e-11
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 4e-11
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 4e-11
4fie_A423 Full-Length Human Pak4 Length = 423 4e-11
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 4e-11
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 5e-11
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-11
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 5e-11
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 5e-11
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 5e-11
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 5e-11
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 5e-11
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 5e-11
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 5e-11
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 5e-11
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 5e-11
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 5e-11
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 6e-11
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 6e-11
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 6e-11
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 6e-11
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 7e-11
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 7e-11
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 7e-11
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 7e-11
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 7e-11
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 8e-11
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 8e-11
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 8e-11
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 8e-11
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-11
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 8e-11
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 1e-10
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 1e-10
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 1e-10
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 1e-10
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 1e-10
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-10
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-10
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 1e-10
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 1e-10
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-10
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 1e-10
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 1e-10
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 1e-10
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 1e-10
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 1e-10
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-10
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 2e-10
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 2e-10
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 2e-10
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 2e-10
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 2e-10
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-10
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 2e-10
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 2e-10
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 2e-10
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 2e-10
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 2e-10
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 2e-10
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 2e-10
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 3e-10
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 3e-10
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 3e-10
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 3e-10
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 3e-10
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 3e-10
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 3e-10
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 3e-10
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-10
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 4e-10
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 4e-10
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 4e-10
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 4e-10
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 4e-10
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 4e-10
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 4e-10
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 4e-10
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 4e-10
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 4e-10
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 4e-10
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 4e-10
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 4e-10
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 4e-10
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 5e-10
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 5e-10
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 5e-10
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 6e-10
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 6e-10
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 6e-10
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 6e-10
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 6e-10
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 6e-10
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 6e-10
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 6e-10
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 6e-10
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 7e-10
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 7e-10
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 7e-10
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 8e-10
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 8e-10
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 8e-10
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 9e-10
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 9e-10
1b6c_B342 Crystal Structure Of The Cytoplasmic Domain Of The 9e-10
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-10
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 9e-10
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 9e-10
1py5_A326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 9e-10
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 9e-10
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 9e-10
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 9e-10
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 1e-09
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 1e-09
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-09
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 1e-09
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 1e-09
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 1e-09
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 1e-09
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 1e-09
3kk9_A282 Camkii Substrate Complex B Length = 282 1e-09
3kk8_A284 Camkii Substrate Complex A Length = 284 1e-09
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 1e-09
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 1e-09
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 1e-09
1rw8_A301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 1e-09
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 1e-09
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 1e-09
2wot_A306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 1e-09
3tzm_A309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 1e-09
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 1e-09
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 1e-09
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 1e-09
1vjy_A303 Crystal Structure Of A Naphthyridine Inhibitor Of H 1e-09
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 1e-09
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 1e-09
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 1e-09
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 1e-09
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 1e-09
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 1e-09
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 1e-09
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 1e-09
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 1e-09
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 1e-09
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 1e-09
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 1e-09
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 1e-09
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 2e-09
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 2e-09
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 2e-09
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 2e-09
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 2e-09
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-09
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 2e-09
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-09
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 2e-09
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 2e-09
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 2e-09
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-09
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-09
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 3e-09
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 3e-09
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 3e-09
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 3e-09
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 3e-09
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 3e-09
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 3e-09
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 4e-09
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 4e-09
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 4e-09
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 4e-09
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 5e-09
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 5e-09
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 5e-09
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 5e-09
4fl3_A635 Structural And Biophysical Characterization Of The 5e-09
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 6e-09
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 6e-09
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-09
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 6e-09
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 6e-09
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 6e-09
3a7f_A303 Human Mst3 Kinase Length = 303 6e-09
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 6e-09
4fl2_A636 Structural And Biophysical Characterization Of The 7e-09
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 7e-09
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 7e-09
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 7e-09
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 7e-09
1rjb_A344 Crystal Structure Of Flt3 Length = 344 7e-09
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 7e-09
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 7e-09
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 7e-09
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 8e-09
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-09
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-09
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 8e-09
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-08
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 1e-08
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 1e-08
3bhy_A283 Crystal Structure Of Human Death Associated Protein 1e-08
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 1e-08
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-08
3b2t_A311 Structure Of Phosphotransferase Length = 311 1e-08
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 1e-08
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 1e-08
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-08
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 1e-08
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 1e-08
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-08
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 1e-08
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 1e-08
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 1e-08
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 1e-08
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 1e-08
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 2e-08
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 2e-08
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-08
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 2e-08
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 2e-08
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 2e-08
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 2e-08
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 2e-08
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-08
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 2e-08
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 2e-08
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-08
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 2e-08
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 2e-08
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 2e-08
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 2e-08
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 2e-08
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 2e-08
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-08
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 2e-08
3g51_A325 Structural Diversity Of The Active Conformation Of 2e-08
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 2e-08
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 2e-08
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 2e-08
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 2e-08
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 2e-08
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-08
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 3e-08
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 3e-08
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 3e-08
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 3e-08
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 3e-08
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 3e-08
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 3e-08
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 3e-08
3h9r_A330 Crystal Structure Of The Kinase Domain Of Type I Ac 3e-08
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-08
3mtf_A301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 3e-08
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-08
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 3e-08
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 3e-08
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-08
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-08
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 4e-08
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 4e-08
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 4e-08
4dym_A301 Crystal Structure Of The Acvr1 Kinase Domain In Com 4e-08
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 4e-08
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 4e-08
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 4e-08
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 5e-08
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 5e-08
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 6e-08
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 7e-08
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 7e-08
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 7e-08
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 8e-08
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 8e-08
3lmg_A344 Crystal Structure Of The Erbb3 Kinase Domain In Com 8e-08
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 9e-08
3kex_A325 Crystal Structure Of The Catalytically Inactive Kin 9e-08
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 9e-08
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 9e-08
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 9e-08
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 1e-07
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 1e-07
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 1e-07
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 1e-07
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 1e-07
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 1e-07
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 1e-07
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 1e-07
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 1e-07
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 1e-07
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 1e-07
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 1e-07
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 1e-07
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 1e-07
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 1e-07
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 1e-07
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 1e-07
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 1e-07
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 2e-07
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 2e-07
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 2e-07
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 2e-07
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 2e-07
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 2e-07
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 2e-07
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 2e-07
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 2e-07
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-07
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 2e-07
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 2e-07
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-07
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 2e-07
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 2e-07
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-07
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-07
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 2e-07
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-07
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-07
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 2e-07
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 2e-07
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 2e-07
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 2e-07
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 3e-07
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 3e-07
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 3e-07
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 3e-07
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-07
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 3e-07
3soa_A 444 Full-Length Human Camkii Length = 444 3e-07
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 3e-07
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 3e-07
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 3e-07
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 3e-07
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 3e-07
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 3e-07
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 3e-07
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 3e-07
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 3e-07
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 3e-07
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 3e-07
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 4e-07
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 4e-07
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-07
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 4e-07
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 4e-07
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 4e-07
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 4e-07
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 4e-07
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 4e-07
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 4e-07
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 4e-07
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 5e-07
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 5e-07
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 5e-07
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 5e-07
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 5e-07
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 5e-07
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 5e-07
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 5e-07
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 5e-07
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 5e-07
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 5e-07
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 5e-07
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 5e-07
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 5e-07
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 5e-07
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 5e-07
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 5e-07
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 6e-07
3my0_A305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 6e-07
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-07
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 6e-07
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 8e-07
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 8e-07
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 9e-07
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 9e-07
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 9e-07
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 1e-06
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-06
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 1e-06
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-06
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 1e-06
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 1e-06
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 1e-06
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 1e-06
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 1e-06
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-06
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-06
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-06
3f5u_A295 Crystal Structure Of The Death Associated Protein K 1e-06
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 1e-06
3hec_A348 P38 In Complex With Imatinib Length = 348 1e-06
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 1e-06
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 1e-06
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 1e-06
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 1e-06
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-06
2oza_B366 Structure Of P38alpha Complex Length = 366 1e-06
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 1e-06
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-06
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 1e-06
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 1e-06
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 2e-06
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 2e-06
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 2e-06
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 2e-06
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 2e-06
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 2e-06
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 2e-06
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-06
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 2e-06
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-06
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 2e-06
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 2e-06
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 2e-06
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 2e-06
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 2e-06
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 2e-06
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 2e-06
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 2e-06
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 2e-06
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 2e-06
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 2e-06
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-06
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 2e-06
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 2e-06
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 3e-06
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 3e-06
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-06
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-06
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 3e-06
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 3e-06
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 3e-06
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 3e-06
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 3e-06
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 3e-06
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-06
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 3e-06
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 4e-06
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 4e-06
3sv0_A 483 Crystal Structure Of Casein Kinase-1 Like Protein I 4e-06
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 4e-06
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-06
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 5e-06
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 6e-06
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 6e-06
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 7e-06
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 7e-06
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 7e-06
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 9e-06
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 9e-06
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 9e-06
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 9e-06
1ckj_A317 Casein Kinase I Delta Truncation Mutant Containing 1e-05
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 1e-05
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 1e-05
3uys_A296 Crystal Structure Of Apo Human Ck1d Length = 296 1e-05
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 1e-05
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 1e-05
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 1e-05
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 1e-05
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 1e-05
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 1e-05
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 1e-05
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 1e-05
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 1e-05
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 2e-05
2pzi_A 681 Crystal Structure Of Protein Kinase Pkng From Mycob 2e-05
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 2e-05
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 2e-05
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 2e-05
4hni_A296 Crystal Structure Of Ck1e In Complex With Pf4800567 2e-05
4ae9_A343 Structure And Function Of The Human Sperm-specific 2e-05
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 2e-05
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 2e-05
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 2e-05
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 2e-05
4ae6_A343 Structure And Function Of The Human Sperm-specific 2e-05
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-05
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 2e-05
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 2e-05
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 2e-05
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 2e-05
1x8b_A289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 2e-05
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 2e-05
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-05
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 2e-05
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 2e-05
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 2e-05
3p23_A 432 Crystal Structure Of The Human Kinase And Rnase Dom 2e-05
2qcs_A350 A Complex Structure Between The Catalytic And Regul 2e-05
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 2e-05
2in6_A287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 2e-05
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-05
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 2e-05
3bi6_A287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 2e-05
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 2e-05
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-05
4f99_A361 Human Cdc7 Kinase In Complex With Dbf4 And Nucleoti 2e-05
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 2e-05
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 2e-05
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 2e-05
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 2e-05
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-05
2z2w_A285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 3e-05
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 3e-05
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 3e-05
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 3e-05
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 3e-05
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-05
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 3e-05
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 3e-05
4fvr_A289 Crystal Structure Of The Jak2 Pseudokinase Domain M 3e-05
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 3e-05
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 3e-05
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 3e-05
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 4e-05
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 4e-05
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 4e-05
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 4e-05
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 4e-05
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 4e-05
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 4e-05
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 4e-05
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 4e-05
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 4e-05
4fst_A269 Crystal Structure Of The Chk1 Length = 269 4e-05
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 4e-05
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 4e-05
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 4e-05
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 4e-05
4fvp_A289 Crystal Structure Of The Jak2 Pseudokinase Domain ( 4e-05
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 4e-05
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 5e-05
4exu_A371 Mapk13, Inactive Form Length = 371 5e-05
1smh_A350 Protein Kinase A Variant Complex With Completely Or 5e-05
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 5e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-05
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 5e-05
2h34_A309 Apoenzyme Crystal Structure Of The Tuberculosis Ser 6e-05
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 6e-05
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 6e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 7e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 7e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 7e-05
3kmu_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 8e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 8e-05
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 8e-05
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 8e-05
3rgf_A405 Crystal Structure Of Human Cdk8CYCC Length = 405 8e-05
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 8e-05
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 8e-05
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 8e-05
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 8e-05
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 8e-05
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 8e-05
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 9e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 9e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 9e-05
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 1e-04
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 1e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-04
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-04
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 1e-04
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 1e-04
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 1e-04
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 1e-04
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 1e-04
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 2e-04
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 2e-04
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 2e-04
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 2e-04
2v62_A345 Structure Of Vaccinia-Related Kinase 2 Length = 345 2e-04
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 2e-04
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 2e-04
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 2e-04
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 2e-04
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 2e-04
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 2e-04
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 2e-04
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 2e-04
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 2e-04
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-04
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 3e-04
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 3e-04
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 3e-04
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 3e-04
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 3e-04
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 3e-04
3ttj_A 464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 3e-04
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 3e-04
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 3e-04
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 3e-04
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 3e-04
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 3e-04
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 3e-04
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 3e-04
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 3e-04
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 4e-04
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 4e-04
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 4e-04
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 4e-04
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 4e-04
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 4e-04
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 4e-04
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 4e-04
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 4e-04
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 4e-04
3ofm_A350 Structure Of A Human Ck2alpha Prime, The Paralog Is 5e-04
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 5e-04
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 5e-04
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 5e-04
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 5e-04
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 5e-04
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 5e-04
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 5e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 157 bits (396), Expect = 4e-38, Method: Compositional matrix adjust. Identities = 105/318 (33%), Positives = 168/318 (52%), Gaps = 30/318 (9%) Query: 665 QFPMISYAELSKATNDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQ-KGASNGF 723 Q S EL A+++FS+ N++G+G FG VYKG L +G +VAVK + ++ +G F Sbjct: 24 QLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLA-DGTLVAVKRLKEERXQGGELQF 82 Query: 724 VAECQALRNIRHRNLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARS 783 E + + HRNL+++ C + + +VY YM NGS+ L + + Q Sbjct: 83 QTEVEMISMAVHRNLLRLRGFCMTPTER-----LLVYPYMANGSVASCLRERPESQP--P 135 Query: 784 LTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSS 843 L +R I + A + Y+H HC P ++H D+K +N+LLD++ A +GDFGLAK + Sbjct: 136 LDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYK 195 Query: 844 PLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFN 903 D V ++GT+G+IAPEY G++S DV+ +G++LLE+ T +R D Sbjct: 196 --DXHV-----XXAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFD---- 244 Query: 904 QGLTLHEFARTALPDKVMEIVDSV--LLLEVQASNSRSCGDERLRTEERLVAVVETGVVC 961 AR A D VM ++D V LL E + + +E + +++ ++C Sbjct: 245 -------LARLANDDDVM-LLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLC 296 Query: 962 SMESPTERMEMRDVVAKL 979 + SP ER +M +VV L Sbjct: 297 TQSSPMERPKMSEVVRML 314
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3IOK|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1CKJ|A Chain A, Casein Kinase I Delta Truncation Mutant Containing Residues 1-317 Complex With Bound Tungstate Length = 317 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3UYS|A Chain A, Crystal Structure Of Apo Human Ck1d Length = 296 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|4HNI|A Chain A, Crystal Structure Of Ck1e In Complex With Pf4800567 Length = 296 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4F99|A Chain A, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide Length = 361 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|4FVR|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain Mutant V617f (Mg- Atp-Bound Form) Length = 289 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|4FVP|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain (Apo Form) Length = 289 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2H34|A Chain A, Apoenzyme Crystal Structure Of The Tuberculosis SerineTHREONINE Kinase, Pkne Length = 309 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|2V62|A Chain A, Structure Of Vaccinia-Related Kinase 2 Length = 345 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query992
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-166
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-148
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-36
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-98
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-65
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-40
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 5e-86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-80
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-48
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-47
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-84
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-76
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-71
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-79
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-73
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-68
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-50
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 5e-69
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3soc_A322 Activin receptor type-2A; structural genomics cons 2e-62
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-56
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-53
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-53
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-52
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-48
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-47
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-52
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-51
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-51
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-36
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 3e-47
3q4u_A301 Activin receptor type-1; structural genomics conso 4e-47
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 5e-47
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 9e-47
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-46
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-46
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-39
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 4e-46
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 1e-45
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 5e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-43
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-42
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-36
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-36
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-23
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-35
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-35
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-35
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 5e-35
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-35
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-34
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-34
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 7e-34
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 8e-34
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 8e-34
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-33
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-33
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-33
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-33
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-33
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-33
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-33
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 4e-33
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 5e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-32
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 6e-33
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 7e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-24
3pls_A298 Macrophage-stimulating protein receptor; protein k 1e-32
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-32
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-32
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-32
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-32
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-32
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 3e-32
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 3e-32
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-32
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-32
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-32
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 4e-32
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-32
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 6e-32
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 6e-32
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 8e-32
3poz_A327 Epidermal growth factor receptor; kinase domain, a 8e-32
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-31
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 1e-31
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-31
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-31
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-31
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-29
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-22
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-31
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 6e-31
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 6e-31
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 8e-31
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 9e-31
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 1e-30
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 6e-30
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 6e-30
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 1e-29
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 1e-29
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-29
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-29
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-29
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-29
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-24
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-29
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 3e-29
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-28
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-28
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-28
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-28
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 5e-28
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 6e-28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-18
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-27
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 1e-27
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 3e-27
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 3e-27
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 4e-27
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 9e-27
4aoj_A329 High affinity nerve growth factor receptor; transf 9e-27
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 2e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-14
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 6e-26
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 7e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-25
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 2e-25
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-25
2xir_A316 Vascular endothelial growth factor receptor 2; ang 2e-25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 3e-25
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-25
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 4e-25
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 4e-25
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 4e-25
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 5e-25
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 9e-25
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 1e-24
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 2e-24
3eqc_A360 Dual specificity mitogen-activated protein kinase; 2e-24
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-24
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-24
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 6e-24
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 9e-24
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-23
3dls_A335 PAS domain-containing serine/threonine-protein KI; 1e-23
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-23
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 1e-23
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 2e-23
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 2e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-07
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-23
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 3e-23
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-23
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 4e-23
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-23
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 4e-23
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-23
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 6e-23
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 7e-23
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 9e-23
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-22
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-07
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-09
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-22
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-22
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 3e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-09
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 4e-22
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-22
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 5e-22
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 6e-22
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-22
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-07
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 9e-22
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-21
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 1e-21
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-21
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-21
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-06
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 6e-21
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 9e-21
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-20
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-20
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 5e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-10
3an0_A340 Dual specificity mitogen-activated protein kinase; 5e-20
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 5e-20
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-20
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 6e-20
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 8e-20
3fme_A290 Dual specificity mitogen-activated protein kinase; 8e-20
3bhy_A283 Death-associated protein kinase 3; death associate 1e-19
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-19
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-19
3aln_A327 Dual specificity mitogen-activated protein kinase; 2e-19
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 2e-19
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-19
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-19
2y0a_A326 Death-associated protein kinase 1; transferase, ca 2e-19
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-19
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 3e-19
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 3e-19
3o0g_A292 Cell division protein kinase 5; kinase activator c 3e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 6e-19
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 6e-19
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 7e-19
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-19
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 8e-19
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 9e-19
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-18
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 2e-18
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-18
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-18
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 5e-18
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 6e-18
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 7e-18
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 7e-18
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 1e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-17
3niz_A311 Rhodanese family protein; structural genomics, str 2e-17
3uqc_A286 Probable conserved transmembrane protein; structur 3e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-16
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 2e-16
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 2e-16
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-16
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 3e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 5e-16
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 6e-16
3rp9_A458 Mitogen-activated protein kinase; structural genom 6e-16
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 8e-16
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 9e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 3e-15
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 3e-15
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 4e-15
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 5e-15
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 6e-15
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 7e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-14
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 1e-14
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-14
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-14
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 2e-14
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 4e-14
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 4e-14
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 4e-14
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 7e-14
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 7e-14
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 8e-14
2fst_X367 Mitogen-activated protein kinase 14; active mutant 1e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 2e-13
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-13
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 3e-13
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 7e-13
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 8e-13
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 1e-12
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 4e-12
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 9e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 3e-11
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 3e-11
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 7e-11
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 8e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 1e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 3e-09
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 3e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-08
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 3e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  506 bits (1305), Expect = e-166
 Identities = 165/567 (29%), Positives = 263/567 (46%), Gaps = 24/567 (4%)

Query: 53  TKLDLSNRTIGGTLSPYVGNLSFLRYLNLADNNFHGEIPHQIGRLVRLEALVLANNSFSG 112
             LD+S+      + P++G+ S L++L+++ N   G+    I     L+ L +++N F G
Sbjct: 203 EFLDVSSNNFSTGI-PFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVG 261

Query: 113 KIPTNLSRCSNLISFNARRNNLVGEIPAELGYNWLKLENLTIADNHLTGHFPASIGNLST 172
            IP       +L   +   N   GEIP  L      L  L ++ NH  G  P   G+ S 
Sbjct: 262 PIPP--LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL 319

Query: 173 LERINVLGNGLWGRIPNN-LGNLRNLILLNLGENRFSGIVPPSIFNIS-SLENVFLPTNR 230
           LE + +  N   G +P + L  +R L +L+L  N FSG +P S+ N+S SL  + L +N 
Sbjct: 320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 379

Query: 231 FNGSLPLDIG-VSLPKLLGFIVAENNFAGSIPESLSNASNLVELTLFDNQFRGKVSIYFR 289
           F+G +  ++       L    +  N F G IP +LSN S LV L L  N   G +     
Sbjct: 380 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 439

Query: 290 SLKNLEWLNLGSNNLGTGEANDLDFLTLLTNCTELTAIGLDDNRFGGVLPHSIANLSSTM 349
           SL  L  L L  N L  GE         L     L  + LD N   G +P  ++N ++ +
Sbjct: 440 SLSKLRDLKLWLNML-EGE-----IPQELMYVKTLETLILDFNDLTGEIPSGLSNCTN-L 492

Query: 350 TDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFLAG 409
             I ++ N+++G IP  I  L NL  L + +N  +G IP  +G+ ++L  L L++N   G
Sbjct: 493 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNG 552

Query: 410 GIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMAD--IELTGALPPQILSIS 467
            IP ++   +      +++N + G     + N     E H A   +E  G    Q+  +S
Sbjct: 553 TIPAAMFKQSGK----IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS 608

Query: 468 TLSLSLDLSYNLLSGTLPLEVGNLKNLVYFNISVNRFSGEIPVTLSACTSLQQLYLQGNS 527
           T +   +++  +  G       N  ++++ ++S N  SG IP  + +   L  L L  N 
Sbjct: 609 TRN-PCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHND 667

Query: 528 FSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFEGEVPTKGVFS 587
            SGSIP  +  L+ +  LD+SSN L G+IP+ +  L+ L  ++LS N+  G +P  G F 
Sbjct: 668 ISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFE 727

Query: 588 NKTGISLSGNGKVCGGLDELNLPPCPS 614
                    N  +CG      LP C  
Sbjct: 728 TFPPAKFLNNPGLCG----YPLPRCDP 750


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query992
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.23
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.19
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 98.95
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.93
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.83
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 98.81
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.53
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.37
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.29
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.27
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.26
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.18
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.03
3ats_A357 Putative uncharacterized protein; hypothetical pro 98.01
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 97.88
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.87
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.66
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.64
2q83_A346 YTAA protein; 2635576, structural genomics, joint 97.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.56
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.35
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.26
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 97.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.16
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 97.11
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 96.96
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 96.83
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 96.78
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 96.7
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 96.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.52
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 96.38
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 96.38
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 96.11
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 95.7
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 95.58
3mes_A424 Choline kinase; malaria, structural genomics, stru 94.51
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 90.82
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=8.2e-80  Score=759.62  Aligned_cols=603  Identities=29%  Similarity=0.466  Sum_probs=468.9

Q ss_pred             CCCCHHHHHHHHHHHhhccCCCCCCCCCCcCCCCCCceEeeEEcCCCCeEEEeeccccccCCc---cC------------
Q 037275            3 VPSNETDRLALLAIGSQLEDDPLGVTSSWNNSTNLCQWTGVTCGHRHQRVTKLDLSNRTIGGT---LS------------   67 (992)
Q Consensus         3 ~~~~~~~~~~ll~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~ldl~~~~l~~~---l~------------   67 (992)
                      ..+.++||+|||+||+++. ||. .+++|+.++|||+|.||+|+  .++|+.|||+++.+.|.   +|            
T Consensus         7 ~~~~~~~~~all~~k~~~~-~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l   82 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLP-DKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESL   82 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCS-CTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEE
T ss_pred             ccCCHHHHHHHHHHHhhCC-Ccc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCccccc
Confidence            4567899999999999996 777 89999989999999999998  68999999999998876   44            


Q ss_pred             -----------CCCCCCCcCCeeeccCCCCCccCCc--cccCCCCCCEEEeecccCCCCCCccc-ccCCCCcEeeccccc
Q 037275           68 -----------PYVGNLSFLRYLNLADNNFHGEIPH--QIGRLVRLEALVLANNSFSGKIPTNL-SRCSNLISFNARRNN  133 (992)
Q Consensus        68 -----------~~l~~l~~L~~L~L~~n~l~~~~p~--~~~~l~~L~~L~Ls~n~l~~~~p~~l-~~l~~L~~L~l~~n~  133 (992)
                                 +.++.+++|++|||++|.+.|.+|.  .++.+++|++|+|++|.+++.+|..+ .++++|++|++++|+
T Consensus        83 ~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~  162 (768)
T 3rgz_A           83 FLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS  162 (768)
T ss_dssp             ECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSC
T ss_pred             CCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCc
Confidence                       5778888888999999888888888  88888888888888888887777765 677777777777777


Q ss_pred             ccccCChhh--c----------------------ccccccccccccccccCCCCCCccccccccceEEecCCcccCCcCC
Q 037275          134 LVGEIPAEL--G----------------------YNWLKLENLTIADNHLTGHFPASIGNLSTLERINVLGNGLWGRIPN  189 (992)
Q Consensus       134 l~~~~p~~~--~----------------------~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~~~  189 (992)
                      +++..|..+  .                      ..+++|++|+|++|.+++.+|. ++++++|++|++++|.+.+.+|.
T Consensus       163 l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~  241 (768)
T 3rgz_A          163 ISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSR  241 (768)
T ss_dssp             CEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHH
T ss_pred             cCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccH
Confidence            775555431  1                      2455666666666666665555 77777777777777777767777


Q ss_pred             ccCCCCcccEEeccCcccccccCccccccCCCcEEeccCCccCCCCCccccccccccchhhccccccCCCCchhhhcccc
Q 037275          190 NLGNLRNLILLNLGENRFSGIVPPSIFNISSLENVFLPTNRFNGSLPLDIGVSLPKLLGFIVAENNFAGSIPESLSNASN  269 (992)
Q Consensus       190 ~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~~L~~l~l~~n~l~~~~p~~l~~l~~  269 (992)
                      .|+++++|++|+|++|++++.+|..  .+++|++|++++|++++.+|..++..+++|++|++++|++.+.+|..|+++++
T Consensus       242 ~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~  319 (768)
T 3rgz_A          242 AISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL  319 (768)
T ss_dssp             HTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTT
T ss_pred             HHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCC
Confidence            7777777777777777777665554  66777777777777777777777766688888888888888888888888888


Q ss_pred             Cceeeecccccccccccc-ccccCccceEecCCCCCCCCCCCCchhhh-------------------hccC--CCcceEe
Q 037275          270 LVELTLFDNQFRGKVSIY-FRSLKNLEWLNLGSNNLGTGEANDLDFLT-------------------LLTN--CTELTAI  327 (992)
Q Consensus       270 L~~L~L~~N~l~~~~~~~-~~~l~~L~~L~L~~N~l~~~~~~~~~~~~-------------------~l~~--~~~L~~L  327 (992)
                      |++|++++|++++.++.. |..+++|++|+|++|+++..-+..+..+.                   .+..  +++|+.|
T Consensus       320 L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L  399 (768)
T 3rgz_A          320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL  399 (768)
T ss_dssp             CCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEE
T ss_pred             ccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEE
Confidence            888888888888666654 88888888888888887633222222211                   1111  4556666


Q ss_pred             ecCCCcCCCcCCcccccccccceeEEeeCCccccccCCCccCCCcccEEEccCCcCCCCCCccccCCCCCcEEeccCccc
Q 037275          328 GLDDNRFGGVLPHSIANLSSTMTDIVIAGNQISGIIPTGIRNLVNLVELCMDDNKLTGTIPHAIGELKNLQLLYLDSNFL  407 (992)
Q Consensus       328 ~l~~n~l~~~~~~~~~~l~~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l  407 (992)
                      ++++|++.+.+|..+..+. +|+.|++++|++++.+|..+..+++|++|++++|++++.+|..+..+++|++|+|++|++
T Consensus       400 ~L~~n~l~~~~p~~l~~l~-~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l  478 (768)
T 3rgz_A          400 YLQNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL  478 (768)
T ss_dssp             ECCSSEEEEECCGGGGGCT-TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCC
T ss_pred             ECCCCccccccCHHHhcCC-CCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcc
Confidence            6666666666666666654 477777777777777777777777777777777777767777777777777777777777


Q ss_pred             cccCCCCCCCccccCceeccCCcccCCCCCCccccccccccccccccccccCchhhhhhcccccccccccccccCcccc-
Q 037275          408 AGGIPTSLGNLTLLTNLALSSNDLQGSIPPSLGNCKNLIELHMADIELTGALPPQILSISTLSLSLDLSYNLLSGTLPL-  486 (992)
Q Consensus       408 ~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~~~~~~~~L~l~~N~l~~~~~~-  486 (992)
                      ++.+|..+.++++|++|+|++|++++.+|.+++.+++|++|++++|++++.+|..+... +.++.|++++|.++|.+|. 
T Consensus       479 ~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l-~~L~~L~Ls~N~l~g~ip~~  557 (768)
T 3rgz_A          479 TGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDC-RSLIWLDLNTNLFNGTIPAA  557 (768)
T ss_dssp             CSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGC-TTCCEEECCSSEEESBCCGG
T ss_pred             cCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCC-CCCCEEECCCCccCCcCChH
Confidence            77777777777777777777777777777777777777777777777777666665543 3344667777776665554 


Q ss_pred             ---------------------------------------------------------------------cccCCCCccEE
Q 037275          487 ---------------------------------------------------------------------EVGNLKNLVYF  497 (992)
Q Consensus       487 ---------------------------------------------------------------------~~~~l~~L~~L  497 (992)
                                                                                           .++.+++|++|
T Consensus       558 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~L  637 (768)
T 3rgz_A          558 MFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFL  637 (768)
T ss_dssp             GGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEE
T ss_pred             HhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEE
Confidence                                                                                 34456789999


Q ss_pred             eeecccccccCCcccccccccceeeccCCcccccCCccccccCCCCEEECCCcccCCCChhhhhcCCCcceEecCCCcCc
Q 037275          498 NISVNRFSGEIPVTLSACTSLQQLYLQGNSFSGSIPSSLSSLKSIKELDMSSNNLSGQIPEYLENLSFLEYLNLSYNHFE  577 (992)
Q Consensus       498 ~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~l~~N~l~  577 (992)
                      ||++|+++|.+|..|+.+++|+.|+|++|+++|.+|..|+++++|+.|||++|+++|.+|..+..+++|++||+++|+++
T Consensus       638 dLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~  717 (768)
T 3rgz_A          638 DMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS  717 (768)
T ss_dssp             ECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEE
T ss_pred             ECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCccCCcccccccCCCCcCCCCCCCCCCCCCCCCCC
Q 037275          578 GEVPTKGVFSNKTGISLSGNGKVCGGLDELNLPPCPSRGLK  618 (992)
Q Consensus       578 ~~~~~~~~~~~~~~~~l~~N~~~C~~~~~~~~~~~~~~~~~  618 (992)
                      |.+|..+.|..+...++.|||++||.|.    ++|+.....
T Consensus       718 g~iP~~~~~~~~~~~~~~gN~~Lcg~~l----~~C~~~~~~  754 (768)
T 3rgz_A          718 GPIPEMGQFETFPPAKFLNNPGLCGYPL----PRCDPSNAD  754 (768)
T ss_dssp             EECCSSSSGGGSCGGGGCSCTEEESTTS----CCCCSCC--
T ss_pred             ccCCCchhhccCCHHHhcCCchhcCCCC----cCCCCCccC
Confidence            9999999999999999999999999875    478765543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 992
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-58
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-54
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 7e-54
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-52
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-51
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-50
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-50
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 6e-50
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-49
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-49
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-49
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-49
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 6e-48
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-47
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-47
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 6e-47
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 8e-47
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-46
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-46
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-46
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 3e-46
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-46
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 7e-45
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 7e-45
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-44
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-43
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-43
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-43
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-43
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-41
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-41
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-41
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-40
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-40
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-39
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-38
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 4e-38
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-38
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 7e-38
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 8e-38
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 9e-38
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-37
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-37
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 6e-37
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 6e-37
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-36
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 4e-36
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-35
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-35
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 7e-35
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 4e-34
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-33
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-32
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-32
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 5e-32
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-31
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-31
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 8e-30
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-29
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-29
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 5e-29
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-28
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-27
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-27
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-20
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-18
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-11
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  199 bits (507), Expect = 3e-58
 Identities = 73/306 (23%), Positives = 124/306 (40%), Gaps = 51/306 (16%)

Query: 679 NDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASN--GFVAECQALRNIRHR 736
              +    IG GSFG VYKG    +   VAVK++N+          F  E   LR  RH 
Sbjct: 8   GQITVGQRIGSGSFGTVYKGKWHGD---VAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHV 64

Query: 737 NLIKIITICSSIDFKGVDFQAIVYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDV 796
           N++  +   ++         AIV ++ +  SL   LH  E         +I+ I+I    
Sbjct: 65  NILLFMGYSTA------PQLAIVTQWCEGSSLYHHLHIIE-----TKFEMIKLIDIARQT 113

Query: 797 ASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAKFLSSSPLDTAVETPSSSK 856
           A  ++Y+H      ++H DLK +N+ L +DL   +GDFGLA   S              +
Sbjct: 114 AQGMDYLHAK---SIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRW------SGSHQFE 164

Query: 857 GIKGTVGYIAPEYGMGGEA---SMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFAR 913
            + G++ ++APE     +    S   DVY+FGI+L E+ T + P   + N+   +    R
Sbjct: 165 QLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGR 224

Query: 914 TALPDKVMEIVDSVLLLEVQASNSRSCGDERLRTEERLVAVVETGVVCSMESPTERMEMR 973
             L   + ++  +                      + +  ++     C  +   ER    
Sbjct: 225 GYLSPDLSKVRSNCP--------------------KAMKRLMAE---CLKKKRDERPLFP 261

Query: 974 DVVAKL 979
            ++A +
Sbjct: 262 QILASI 267


>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query992
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.54
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.44
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.4
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.5
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.44
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.4
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 97.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.73
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 96.35
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 96.08
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.3e-49  Score=421.10  Aligned_cols=250  Identities=22%  Similarity=0.301  Sum_probs=206.4

Q ss_pred             cCCCCCCccccccceEEEEeEECCCCeEEEEEEeeccCCCchhHHHHHHHHHHhccCCcceeEEEEeecccccCcceEEE
Q 037275          679 NDFSSSNMIGQGSFGFVYKGNLGENGMMVAVKVINLKQKGASNGFVAECQALRNIRHRNLIKIITICSSIDFKGVDFQAI  758 (992)
Q Consensus       679 ~~~~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~~~~~~~~~~~E~~~l~~l~h~niv~~~~~~~~~~~~~~~~~~l  758 (992)
                      ++|++.+.||+|+||+||+|++..+|+.||||+++.......+.+.+|++++++++||||+++++++.     ..+..++
T Consensus        20 ~~Y~~~~~iG~G~fg~Vy~a~~~~~~~~vAvK~~~~~~~~~~~~~~~E~~il~~l~HpnIv~~~~~~~-----~~~~~~i   94 (293)
T d1yhwa1          20 KKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYL-----VGDELWV   94 (293)
T ss_dssp             TTBCSCEECCCSSSCEEEEEEBTTTCCEEEEEEEEGGGCSCHHHHHHHHHHHHHCCCTTBCCEEEEEE-----ETTEEEE
T ss_pred             cccEEEEEEecCcCcEEEEEEECCCCCEEEEEEEecccChHHHHHHHHHHHHHhCCCCCEeeEeEEEE-----ECCEEEE
Confidence            47999999999999999999999999999999998766666788999999999999999999999964     3456799


Q ss_pred             EEEeccCCCHHHHHhhcccchhhcccCHHHHHHHHHHHHHHHHHHHhcCCCCeEeccCCCCCeeeCCCCcEEEeecccce
Q 037275          759 VYEYMQNGSLEDWLHQSEDQQEARSLTLIQRINIIIDVASAIEYIHHHCQPPVVHGDLKPSNVLLDQDLVAHLGDFGLAK  838 (992)
Q Consensus       759 v~e~~~~gsL~~~l~~~~~~~~~~~l~~~~~~~i~~qi~~~L~~LH~~~~~~ivH~Dlkp~NIll~~~~~~kl~Dfg~a~  838 (992)
                      ||||+++|+|.+++.+.       .+++.++..++.||+.||+|||++   ||+||||||+|||++.++.+||+|||+|+
T Consensus        95 vmEy~~gg~L~~~~~~~-------~l~~~~~~~i~~qi~~aL~yLH~~---~iiHrDiKp~NILl~~~~~vkl~DFG~a~  164 (293)
T d1yhwa1          95 VMEYLAGGSLTDVVTET-------CMDEGQIAAVCRECLQALEFLHSN---QVIHRDIKSDNILLGMDGSVKLTDFGFCA  164 (293)
T ss_dssp             EEECCTTCBHHHHHHHS-------CCCHHHHHHHHHHHHHHHHHHHHT---TEECCCCSGGGEEECTTCCEEECCCTTCE
T ss_pred             EEEecCCCcHHHHhhcc-------CCCHHHHHHHHHHHHHHHHHHHHC---CCcccCCcHHHeEECCCCcEeeccchhhe
Confidence            99999999999987643       489999999999999999999999   99999999999999999999999999998


Q ss_pred             ecCCCCCCCCcccCCCCCcccccccccccccccCCCcCcccchhhHHHHHHHHHhCCCCCCCCccCCccHHHHHhhhCCh
Q 037275          839 FLSSSPLDTAVETPSSSKGIKGTVGYIAPEYGMGGEASMTGDVYSFGILLLEMFTRRRPTDGMFNQGLTLHEFARTALPD  918 (992)
Q Consensus       839 ~~~~~~~~~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~~DiwSlG~il~elltg~~pf~~~~~~~~~~~~~~~~~~~~  918 (992)
                      .+....        .......||+.|+|||++.+..++.++||||+||++|||++|+.||.+....              
T Consensus       165 ~~~~~~--------~~~~~~~gt~~Y~aPE~~~~~~~~~~~DiwSlGvilyemltG~~Pf~~~~~~--------------  222 (293)
T d1yhwa1         165 QITPEQ--------SKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPL--------------  222 (293)
T ss_dssp             ECCSTT--------CCBCCCCSCGGGCCHHHHSSSCBCTHHHHHHHHHHHHHHHHSSCTTTTSCHH--------------
T ss_pred             eecccc--------ccccccccCCCccChhhhcCCCCCchhceehHhHHHHHHhhCCCCCCCCCHH--------------
Confidence            765321        1223457999999999999999999999999999999999999999753211              


Q ss_pred             hHHHHHHhhHhHhhhccCCCCCCccccchHHHHHHHHHHHhhccCCCCCCCCCHHHHHH
Q 037275          919 KVMEIVDSVLLLEVQASNSRSCGDERLRTEERLVAVVETGVVCSMESPTERMEMRDVVA  977 (992)
Q Consensus       919 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~li~~cl~~dP~~RPs~~evl~  977 (992)
                         +.+..........     .    ........++.+++.+||+.||++|||++|+++
T Consensus       223 ---~~~~~~~~~~~~~-----~----~~~~~~s~~~~~li~~~L~~dP~~R~s~~eil~  269 (293)
T d1yhwa1         223 ---RALYLIATNGTPE-----L----QNPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQ  269 (293)
T ss_dssp             ---HHHHHHHHHCSCC-----C----SSGGGSCHHHHHHHHHHTCSSTTTSCCHHHHTT
T ss_pred             ---HHHHHHHhCCCCC-----C----CCcccCCHHHHHHHHHHccCChhHCcCHHHHhc
Confidence               0111111110000     0    000112345889999999999999999999975



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure