Citrus Sinensis ID: 037296


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
YLIVNPENGGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSVRLGKERTIQMSSF
cEEEEcccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccEEEccccccccHHHHcccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccccEEEEEEEEccccccEEEEEEcccccccHHHHHHHcccccccccccccccccHHHHHHccccccccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHcccccccccccEEEEccccccccHHHHHHHHHHHccccccEEEEEEcccccccccccccccccEEccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccccccc
cEEEccccccHHHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccEEcccccccccEEEEcccccccccccccccHHHcccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEEcccccccEEEEEEcccccccHHHHccccccccccccccccHHHHHHHHHccccccccccHHHHHccccccHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHHcccHHHHHHHccEEEccccccccHHHHHHHHHHHccccccEEEEEEcccccccccccccccEEEcccEEEEEccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccEEcccc
ylivnpenggmVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLakpmeytgFVVDFTLNLLSQNGNIFGLLYSLLHgkvviprrgtetFLSTIGqldgridlykgqylteqlrysdvgqsgiEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFiltdkpkdaTLILISFrgtepfdaddwctdfdyswyeipklgkvHMGFLEalglgnradtvtfqnhllgkeakfrdrssdseelpstgndcippgkmELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGvytfgqprigneRIGRFMKahlespvqKYFRVVYCndmvprlpyddktfsykhfGVCLFYNSCyieqkvdeepnknffglrYLIPVYLNALWELIRSLTmgythgpqyeeGWFSIFARILGlafpgisahcptdyvnsvrlgkerTIQMSSF
ylivnpengGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFlstigqldgriDLYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFrgtepfdadDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHllgkeakfrdrssdseelpstgndcippgkMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSvrlgkertiqmssf
YLIVNPENGGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSVRLGKERTIQMSSF
*******NGGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLG**************************KMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSVRL***********
YLIVNP*NGGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSVRLGKER**QM***
YLIVNPENGGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAK**************GNDCIPPGKMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSVRLGKERTIQMSSF
YLIVNPENGGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYL*********GQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSVRLGKERTIQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YLIVNPENGGMVDLLKYLLLGDISSAADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPGISAHCPTDYVNSVRLGKERTIQMSSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query490 2.2.26 [Sep-21-2011]
O42807281 Feruloyl esterase A OS=As yes no 0.230 0.402 0.317 5e-10
A2QSY5281 Probable feruloyl esteras yes no 0.230 0.402 0.310 1e-09
Q0CBM7281 Probable feruloyl esteras N/A no 0.208 0.362 0.316 3e-09
Q9P979281 Feruloyl esterase A OS=As N/A no 0.2 0.348 0.330 7e-09
O59952291 Lipase OS=Thermomyces lan N/A no 0.187 0.316 0.320 1e-08
B8NIB8281 Probable feruloyl esteras N/A no 0.202 0.352 0.271 6e-08
Q2UNW5281 Probable feruloyl esteras no no 0.208 0.362 0.273 8e-08
P61872392 Lipase OS=Rhizopus oryzae N/A no 0.306 0.382 0.294 3e-07
P61871392 Lipase OS=Rhizopus niveus N/A no 0.306 0.382 0.294 3e-07
O42815280 Feruloyl esterase A OS=As N/A no 0.193 0.339 0.302 3e-07
>sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 Back     alignment and function desciption
 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 16/129 (12%)

Query: 273 NDCIPPGKMELTAYYAVKNKLKSLLEEHKKA----KFVVTGHSLGGALAILFPTVLVLHD 328
           NDC   G   +  + +V+++++SL+++           VTGHSLG ++A L         
Sbjct: 113 NDCEVHGGYYI-GWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAA------ 165

Query: 329 EMEIMHSLLGVYTFGQPRIGNERIGRFMKA--HLESP-VQKYFRVVYCNDMVPRLPYDDK 385
           ++   +  + +YTFG+PR GN+    +M     + SP   +YFRV + ND +P LP  D+
Sbjct: 166 QLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADE 225

Query: 386 TFSYKHFGV 394
              Y H GV
Sbjct: 226 --GYAHGGV 232




Involved in degradation of plant cell walls. Hydrolyzes the feruloyl-arabinose ester bond in arabinoxylans, and the feruloyl-galactose ester bond in pectin. Binds to cellulose.
Aspergillus niger (taxid: 5061)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 3
>sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 Back     alignment and function description
>sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 Back     alignment and function description
>sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 Back     alignment and function description
>sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 Back     alignment and function description
>sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 Back     alignment and function description
>sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 Back     alignment and function description
>sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 Back     alignment and function description
>sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 Back     alignment and function description
>sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
224071031516 predicted protein [Populus trichocarpa] 0.965 0.916 0.673 0.0
224137780482 predicted protein [Populus trichocarpa] 0.951 0.966 0.675 0.0
147853719487 hypothetical protein VITISV_027895 [Viti 0.930 0.936 0.650 0.0
359482436492 PREDICTED: uncharacterized protein LOC10 0.940 0.936 0.662 0.0
297742916481 unnamed protein product [Vitis vinifera] 0.918 0.935 0.646 1e-179
300119936456 triacylglycerol lipase [Ricinus communis 0.885 0.951 0.670 1e-178
449461707530 PREDICTED: uncharacterized protein LOC10 0.981 0.907 0.593 1e-177
255585241434 triacylglycerol lipase, putative [Ricinu 0.867 0.979 0.683 1e-175
42564151518 lipase class 3 family protein [Arabidops 0.975 0.922 0.613 1e-174
297829988521 lipase class 3 family protein [Arabidops 0.975 0.917 0.611 1e-172
>gi|224071031|ref|XP_002303338.1| predicted protein [Populus trichocarpa] gi|222840770|gb|EEE78317.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/506 (67%), Positives = 390/506 (77%), Gaps = 33/506 (6%)

Query: 1   YLIVNPENGGMVDLLKYLLLGDISS----------------AADHRWVIAVSIIARKIIG 44
           YLIV PE GG++DLL+YL+  DI S                A DHRW+I VSII RKII 
Sbjct: 28  YLIVRPEKGGILDLLRYLVWADIGSGVKFLESSDEGIMGGEAVDHRWIILVSIIVRKIIS 87

Query: 45  FLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRID 104
            L KPMEYTGFV DF LNLL QNG I GL  + L GKVV P+R TETF+STIG LDGRID
Sbjct: 88  LLGKPMEYTGFVADFFLNLLFQNGGIMGLFLNFLQGKVVTPQRDTETFISTIGHLDGRID 147

Query: 105 LYKGQYLTEQLRYSDVGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQMH 164
           LY+ + L EQL  S   +     E+ NR LMDLCIMASKLAYENA+VV+++V      MH
Sbjct: 148 LYRDENLLEQLDNSVSAEKIATEEIGNRALMDLCIMASKLAYENAKVVQSIV------MH 201

Query: 165 FVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPK 224
           FVDFYNCWNDF+KEMSTQVFIL DKPKDA LILISFRGTEPFDADDW TDFDYSWYEIPK
Sbjct: 202 FVDFYNCWNDFQKEMSTQVFILCDKPKDANLILISFRGTEPFDADDWGTDFDYSWYEIPK 261

Query: 225 LGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELT 284
           LG+VHMGFLEALGLGNRADT TF NHL  K   F           + G+      K++ T
Sbjct: 262 LGRVHMGFLEALGLGNRADTATFHNHLQMKSTSF-----------NHGHKKFLSEKVKKT 310

Query: 285 AYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQ 344
           AYYAV+ KL+S+L EHK AKFVVTGHSLGGALA+LFPTVLVLH + +IM  LLGVYTFGQ
Sbjct: 311 AYYAVRKKLESILMEHKNAKFVVTGHSLGGALAVLFPTVLVLHQQTDIMKRLLGVYTFGQ 370

Query: 345 PRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIE 404
           PRIGN ++ +FM+AHLE PV KYFRVVY  D+VPRLP DDKTF YKHFGVCL+YNS YIE
Sbjct: 371 PRIGNLQLAKFMEAHLEYPVPKYFRVVYSYDLVPRLPCDDKTFLYKHFGVCLYYNSLYIE 430

Query: 405 QKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFPG 464
           QK+DEEP+ NF+GLR ++  +LN++WELIRS  +GYTHGP Y+E WF +FARI+GLA PG
Sbjct: 431 QKLDEEPDPNFYGLRNVVSAHLNSVWELIRSFVVGYTHGPMYKESWFMVFARIMGLALPG 490

Query: 465 ISAHCPTDYVNSVRLGKERTIQMSSF 490
           I+AHCPTDYVNSVRLGKER ++MSSF
Sbjct: 491 IAAHCPTDYVNSVRLGKERVVRMSSF 516




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224137780|ref|XP_002326438.1| predicted protein [Populus trichocarpa] gi|222833760|gb|EEE72237.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147853719|emb|CAN80222.1| hypothetical protein VITISV_027895 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482436|ref|XP_002270932.2| PREDICTED: uncharacterized protein LOC100246343 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742916|emb|CBI35783.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|300119936|gb|ADJ67993.1| triacylglycerol lipase [Ricinus communis] Back     alignment and taxonomy information
>gi|449461707|ref|XP_004148583.1| PREDICTED: uncharacterized protein LOC101204315 [Cucumis sativus] gi|449508114|ref|XP_004163223.1| PREDICTED: uncharacterized LOC101204315 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255585241|ref|XP_002533322.1| triacylglycerol lipase, putative [Ricinus communis] gi|223526844|gb|EEF29058.1| triacylglycerol lipase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|42564151|ref|NP_566484.2| lipase class 3 family protein [Arabidopsis thaliana] gi|332641986|gb|AEE75507.1| lipase class 3 family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297829988|ref|XP_002882876.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata] gi|297328716|gb|EFH59135.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
TAIR|locus:2091025518 AT3G14360 [Arabidopsis thalian 0.973 0.920 0.614 5.1e-161
TAIR|locus:2160016467 AT5G42930 [Arabidopsis thalian 0.404 0.423 0.550 6.4e-108
TAIR|locus:2027584485 AT1G56630 [Arabidopsis thalian 0.410 0.414 0.512 8.6e-100
TAIR|locus:1005716681479 TLL1 "triacylglycerol lipase-l 0.397 0.407 0.510 1.6e-93
TAIR|locus:2155538477 AT5G67050 [Arabidopsis thalian 0.412 0.423 0.490 8.9e-92
TIGR_CMR|CPS_1781277 CPS_1781 "lipase family protei 0.238 0.422 0.325 1.4e-10
DICTYBASE|DDB_G0291394278 DDB_G0291394 "Putative lipase 0.220 0.388 0.305 3e-09
TAIR|locus:2180054358 AT5G18630 [Arabidopsis thalian 0.161 0.220 0.377 3.4e-08
UNIPROTKB|O42807281 faeA "Feruloyl esterase A" [As 0.240 0.419 0.328 3.6e-08
UNIPROTKB|Q9P979281 faeA "Feruloyl esterase A" [As 0.2 0.348 0.330 4e-07
TAIR|locus:2091025 AT3G14360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1568 (557.0 bits), Expect = 5.1e-161, P = 5.1e-161
 Identities = 314/511 (61%), Positives = 370/511 (72%)

Query:     1 YLIVNPENGGMVDLLKYLLLGDISSAA---------------------DHRWVIAVSIIA 39
             YLIV P  GG +DL +Y +  D +S A                     DHRWVI VSI+ 
Sbjct:    19 YLIVRPHRGGYIDLFRYGVRDDQTSKAKFLEMPDNREWSTITIDEEAEDHRWVIVVSILV 78

Query:    40 RKIIGFLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQL 99
             RKII  L  PME+TGFVVDF LNL S NG  FGLL  L+  KVVIP RG+ TF+STIGQL
Sbjct:    79 RKIIRLLRTPMEFTGFVVDFFLNLFSANGGFFGLLLRLIQAKVVIPERGSVTFVSTIGQL 138

Query:   100 DGRIDLYKGQYLTEQLRYSDVGQSG-IEMELVNRILMDLCIMASKLAYENAEVVRNVVVD 158
             DGRI LYK     E L   D   SG +++EL +R LMDLC+MASKLAYENA+VV NVV  
Sbjct:   139 DGRISLYKEWNFVEHLEGIDSVDSGRVKIELGSRGLMDLCVMASKLAYENAKVVENVVDL 198

Query:   159 HWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYS 218
             HWK M+ V+F +CWND++K+MSTQVF+ TDK KDA LI+ISFRGTEPFDADDW TDFDYS
Sbjct:   199 HWK-MNLVEFLDCWNDYQKQMSTQVFVFTDKQKDANLIVISFRGTEPFDADDWGTDFDYS 257

Query:   219 WYEIPKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPP 278
             WYE+P +GK+HMGFLEA+GLGNR DT TF  +L      F   SS+ E       D +  
Sbjct:   258 WYEVPNVGKLHMGFLEAMGLGNRDDTTTFHYNL------FEQTSSEEENSKKNLLDMV-- 309

Query:   279 GKMELTAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLG 338
                E +AYYAV+  LK LL EH+ A+FVVTGHSLGGALAILFPT+LVL++E EIM  LLG
Sbjct:   310 ---ERSAYYAVRVILKRLLSEHENARFVVTGHSLGGALAILFPTLLVLNEETEIMKRLLG 366

Query:   339 VYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFY 398
             VYTFGQPRIGN  +G FMKA L  PV +YFRVVYCND+VPRLPYDDKTF YKHFG+CLFY
Sbjct:   367 VYTFGQPRIGNREVGLFMKAQLNQPVDRYFRVVYCNDIVPRLPYDDKTFLYKHFGLCLFY 426

Query:   399 NSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARIL 458
             +S Y E K ++EP+ N +GLRY I  ++ A+WEL+R LTMGYTHGP Y+EGWF I  R++
Sbjct:   427 DSFYNETKAEDEPDPNPYGLRYKILGHVIAVWELVRGLTMGYTHGPDYKEGWFRILFRLM 486

Query:   459 GLAFPGISAHCPTDYVNSVRLGKERTIQMSS 489
             GL  PG+S HC TDYVNSVRLG +  +QMSS
Sbjct:   487 GLVIPGLSDHCMTDYVNSVRLGPDNELQMSS 517




GO:0004806 "triglyceride lipase activity" evidence=IEA;ISS
GO:0006629 "lipid metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2160016 AT5G42930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027584 AT1G56630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716681 TLL1 "triacylglycerol lipase-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155538 AT5G67050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1781 CPS_1781 "lipase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291394 DDB_G0291394 "Putative lipase YJR107W" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2180054 AT5G18630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O42807 faeA "Feruloyl esterase A" [Aspergillus niger (taxid:5061)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P979 faeA "Feruloyl esterase A" [Aspergillus awamori (taxid:105351)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
PLN02934515 PLN02934, PLN02934, triacylglycerol lipase 0.0
PLN00413479 PLN00413, PLN00413, triacylglycerol lipase 1e-145
PLN02162475 PLN02162, PLN02162, triacylglycerol lipase 1e-116
cd00519229 cd00519, Lipase_3, Lipase (class 3) 2e-45
pfam01764141 pfam01764, Lipase_3, Lipase (class 3) 3e-30
cd00741153 cd00741, Lipase, Lipase 2e-26
PLN02802509 PLN02802, PLN02802, triacylglycerol lipase 2e-07
PLN03037525 PLN03037, PLN03037, lipase class 3 family protein; 5e-07
PLN02408365 PLN02408, PLN02408, phospholipase A1 6e-07
PLN02310405 PLN02310, PLN02310, triacylglycerol lipase 4e-06
PLN02753531 PLN02753, PLN02753, triacylglycerol lipase 1e-05
PLN02324415 PLN02324, PLN02324, triacylglycerol lipase 2e-05
PLN02719518 PLN02719, PLN02719, triacylglycerol lipase 5e-05
PLN02761527 PLN02761, PLN02761, lipase class 3 family protein 8e-05
PLN02454414 PLN02454, PLN02454, triacylglycerol lipase 5e-04
COG5153425 COG5153, CVT17, Putative lipase essential for disi 0.001
COG3675332 COG3675, COG3675, Predicted lipase [Lipid metaboli 0.002
>gnl|CDD|215504 PLN02934, PLN02934, triacylglycerol lipase Back     alignment and domain information
 Score =  823 bits (2128), Expect = 0.0
 Identities = 341/507 (67%), Positives = 384/507 (75%), Gaps = 27/507 (5%)

Query: 1   YLIVNPENGGMVDLLKYLLLGDISS----------------AADHRWVIAVSIIARKIIG 44
           YLIV P+ GG +DL +YL+ GD  S                A DHRWVI VSII RKII 
Sbjct: 12  YLIVRPDKGGFLDLFRYLVRGDQGSGAKFLESSDERVPGEEAVDHRWVILVSIIIRKIIA 71

Query: 45  FLAKPMEYTGFVVDFTLNLLSQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRID 104
               PMEYTGFVVDF LNL SQNG   GLL +LL GKVVIP+RG+ETF+STIG LDGRID
Sbjct: 72  LFGTPMEYTGFVVDFFLNLFSQNGGFLGLLLNLLQGKVVIPQRGSETFISTIGHLDGRID 131

Query: 105 LYKGQYLTEQLRYSD-VGQSGIEMELVNRILMDLCIMASKLAYENAEVVRNVVVDHWKQM 163
           LYK   L EQL  S     S I+ EL NR LMDLCIMASKLAYENA+VV NVV  HWK M
Sbjct: 132 LYKTPNLVEQLDDSVSNHNSKIKGELGNRALMDLCIMASKLAYENAKVVENVVDHHWK-M 190

Query: 164 HFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIP 223
           HFV FYNCWNDF+K+MSTQVFI  DKPKDA LI+ISFRGTEPFDADDW TDFDYSWYEIP
Sbjct: 191 HFVAFYNCWNDFQKQMSTQVFIFCDKPKDANLIVISFRGTEPFDADDWGTDFDYSWYEIP 250

Query: 224 KLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMEL 283
           K+GKVHMGFLEA+GLGNR DT TFQ  L  K           + L            +E 
Sbjct: 251 KVGKVHMGFLEAMGLGNRDDTTTFQTSLQTKATSELKEEESKKNLLE---------MVER 301

Query: 284 TAYYAVKNKLKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFG 343
           +AYYAV++KLKSLL+EHK AKFVVTGHSLGGALAILFPTVLVL +E E+M  LLGVYTFG
Sbjct: 302 SAYYAVRSKLKSLLKEHKNAKFVVTGHSLGGALAILFPTVLVLQEETEVMKRLLGVYTFG 361

Query: 344 QPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYI 403
           QPRIGN ++G+FM+A L  PV +YFRVVYCND+VPRLPYDDKTF YKHFGVCL+Y+S Y 
Sbjct: 362 QPRIGNRQLGKFMEAQLNYPVPRYFRVVYCNDLVPRLPYDDKTFLYKHFGVCLYYDSRYF 421

Query: 404 EQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFP 463
            QK+DEEP++N FGLR  I  +LNA+WEL RS  MGYTHGP+Y+EGWFSIF RI+GL  P
Sbjct: 422 GQKMDEEPDRNPFGLRNAISAHLNAVWELWRSFIMGYTHGPEYKEGWFSIFFRIMGLVLP 481

Query: 464 GISAHCPTDYVNSVRLGKERTIQMSSF 490
           G++AH PTDYVNSVRLG+ER + MSS 
Sbjct: 482 GVAAHSPTDYVNSVRLGRERVVPMSSL 508


Length = 515

>gnl|CDD|165792 PLN00413, PLN00413, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|177821 PLN02162, PLN02162, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) Back     alignment and domain information
>gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) Back     alignment and domain information
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|215432 PLN02802, PLN02802, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215547 PLN03037, PLN03037, lipase class 3 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215228 PLN02408, PLN02408, phospholipase A1 Back     alignment and domain information
>gnl|CDD|215176 PLN02310, PLN02310, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|178354 PLN02753, PLN02753, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|177958 PLN02324, PLN02324, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|178321 PLN02719, PLN02719, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215406 PLN02761, PLN02761, lipase class 3 family protein Back     alignment and domain information
>gnl|CDD|215249 PLN02454, PLN02454, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|227482 COG5153, CVT17, Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|226200 COG3675, COG3675, Predicted lipase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 490
PLN02934515 triacylglycerol lipase 100.0
PLN00413479 triacylglycerol lipase 100.0
PLN02162475 triacylglycerol lipase 100.0
PLN02310405 triacylglycerol lipase 100.0
PLN02802509 triacylglycerol lipase 100.0
PLN02324415 triacylglycerol lipase 100.0
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 100.0
KOG4569336 consensus Predicted lipase [Lipid transport and me 100.0
PLN02454414 triacylglycerol lipase 100.0
PLN02571413 triacylglycerol lipase 100.0
PLN02408365 phospholipase A1 100.0
PLN02753531 triacylglycerol lipase 100.0
PLN03037525 lipase class 3 family protein; Provisional 100.0
PLN02719518 triacylglycerol lipase 100.0
PLN02761527 lipase class 3 family protein 99.97
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 99.96
PLN02847 633 triacylglycerol lipase 99.9
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.84
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 99.58
COG3675332 Predicted lipase [Lipid metabolism] 98.89
KOG4540425 consensus Putative lipase essential for disintegra 98.83
COG5153425 CVT17 Putative lipase essential for disintegration 98.83
COG3675332 Predicted lipase [Lipid metabolism] 98.51
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 97.14
KOG2088 596 consensus Predicted lipase/calmodulin-binding heat 96.48
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.29
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 95.64
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 95.47
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 95.21
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 95.06
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 94.86
KOG2564343 consensus Predicted acetyltransferases and hydrola 94.83
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 94.81
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 94.81
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 94.63
PHA02857276 monoglyceride lipase; Provisional 94.59
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.49
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 94.44
PRK10673255 acyl-CoA esterase; Provisional 94.36
PRK10985324 putative hydrolase; Provisional 94.25
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 94.23
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 94.2
PLN02824294 hydrolase, alpha/beta fold family protein 94.14
PLN02965255 Probable pheophorbidase 94.08
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 94.08
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 94.06
PRK11071190 esterase YqiA; Provisional 94.05
TIGR03611257 RutD pyrimidine utilization protein D. This protei 93.57
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 93.56
COG3208244 GrsT Predicted thioesterase involved in non-riboso 93.5
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 93.46
PRK10749330 lysophospholipase L2; Provisional 93.43
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 93.35
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 93.33
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 93.14
COG2267298 PldB Lysophospholipase [Lipid metabolism] 93.12
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 93.09
PRK00870302 haloalkane dehalogenase; Provisional 93.06
PLN02511388 hydrolase 93.01
PLN02298330 hydrolase, alpha/beta fold family protein 92.85
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 92.66
COG4782377 Uncharacterized protein conserved in bacteria [Fun 92.49
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 92.07
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 92.05
PRK03204286 haloalkane dehalogenase; Provisional 91.81
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 91.77
PLN02385349 hydrolase; alpha/beta fold family protein 91.74
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 91.73
PLN02652395 hydrolase; alpha/beta fold family protein 91.71
PLN02211273 methyl indole-3-acetate methyltransferase 91.64
PF10503220 Esterase_phd: Esterase PHB depolymerase 91.42
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 91.38
PRK03592295 haloalkane dehalogenase; Provisional 91.35
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 91.14
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 91.08
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 91.02
PRK10566249 esterase; Provisional 90.94
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 90.93
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 90.61
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 90.57
KOG1455313 consensus Lysophospholipase [Lipid transport and m 90.56
COG3319257 Thioesterase domains of type I polyketide synthase 90.16
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 89.93
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 89.8
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 89.49
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 89.29
PLN02894402 hydrolase, alpha/beta fold family protein 89.25
PLN02442283 S-formylglutathione hydrolase 89.14
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 89.0
PRK13604307 luxD acyl transferase; Provisional 88.92
PLN02578354 hydrolase 88.82
PLN02679360 hydrolase, alpha/beta fold family protein 88.71
PRK08775343 homoserine O-acetyltransferase; Provisional 88.51
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 88.5
KOG2088596 consensus Predicted lipase/calmodulin-binding heat 88.5
PRK10349256 carboxylesterase BioH; Provisional 88.29
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 87.75
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 87.52
PRK00175379 metX homoserine O-acetyltransferase; Provisional 87.0
PLN00021313 chlorophyllase 86.66
PRK06489360 hypothetical protein; Provisional 86.21
PRK11460232 putative hydrolase; Provisional 86.0
PRK10162318 acetyl esterase; Provisional 85.71
PRK07581339 hypothetical protein; Validated 85.47
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 85.42
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 85.36
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 84.88
PRK05077414 frsA fermentation/respiration switch protein; Revi 84.64
PLN02872395 triacylglycerol lipase 84.31
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 84.15
KOG3724 973 consensus Negative regulator of COPII vesicle form 84.14
PRK04940180 hypothetical protein; Provisional 83.78
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 83.72
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 83.52
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 83.2
PRK06765389 homoserine O-acetyltransferase; Provisional 82.66
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 82.44
PRK05855 582 short chain dehydrogenase; Validated 82.33
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 81.92
PLN03084383 alpha/beta hydrolase fold protein; Provisional 80.99
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 80.53
>PLN02934 triacylglycerol lipase Back     alignment and domain information
Probab=100.00  E-value=2.2e-135  Score=1066.98  Aligned_cols=480  Identities=71%  Similarity=1.184  Sum_probs=436.1

Q ss_pred             CeeecCCCCChhHHHHHhhcccc--------------ccc--cCCchhHHHHHHHHHHHHHhcchhhhchhhHHHHhhhh
Q 037296            1 YLIVNPENGGMVDLLKYLLLGDI--------------SSA--ADHRWVIAVSIIARKIIGFLAKPMEYTGFVVDFTLNLL   64 (490)
Q Consensus         1 ~~~~~p~~~~~~~~~~~~~~~~~--------------~~~--~~~~w~~~~~~~~~~~l~~~~~~~~~~g~~~e~~ln~~   64 (490)
                      ||||||||++++|||++|+++|+              +++  .++||+|++|+++||+|+++++||+++|.++||||||+
T Consensus        12 ~~i~~p~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~rW~i~vS~~~~k~l~~~~~p~~~~G~~~e~~lNl~   91 (515)
T PLN02934         12 YLIVRPDKGGFLDLFRYLVRGDQGSGAKFLESSDERVPGEEAVDHRWVILVSIIIRKIIALFGTPMEYTGFVVDFFLNLF   91 (515)
T ss_pred             eEEEccCcCCHHHHHHHHhccccccCcceeeCCCcccccccccCcchHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHH
Confidence            89999999999999999999998              122  35699999999999999999999999999999999999


Q ss_pred             hccCcHHHHHhhhccceEeecCCCCchhhhhhcccccccccccccchhhcccccccc-cccccccccchHHHHHHHHHHH
Q 037296           65 SQNGNIFGLLYSLLHGKVVIPRRGTETFLSTIGQLDGRIDLYKGQYLTEQLRYSDVG-QSGIEMELVNRILMDLCIMASK  143 (490)
Q Consensus        65 ~~n~g~~~~~~~~~~g~~~~p~~~s~~~~s~~g~~d~r~~l~~~~~~~~~~~~~~~~-~~~~~~~~g~~~~a~l~~mASk  143 (490)
                      ++|||++|||+|+|+||+|+|+|+|+||+|+||+||+||||+++++..++++.+... ++++++++|+||+||||+||||
T Consensus        92 ~~Ngg~~~ll~n~l~g~~~~p~r~s~~f~S~ig~ld~R~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~imAsk  171 (515)
T PLN02934         92 SQNGGFLGLLLNLLQGKVVIPQRGSETFISTIGHLDGRIDLYKTPNLVEQLDDSVSNHNSKIKGELGNRALMDLCIMASK  171 (515)
T ss_pred             HhcCChHHHHHHHhcCcEEecCCCCchHHHHhhccCcceeccccCCccccccccccccccccccccchhhHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999988887744433 4588999999999999999999


Q ss_pred             HhccChHhHhhhhhcccceeeeeecccccccCcCccCeEEEEEEEcCCCCCeEEEEEcCCCcCChhcHHhhccccccccC
Q 037296          144 LAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIP  223 (490)
Q Consensus       144 lAYen~~~i~~~v~~~W~~~~~v~~~~~~n~~~~~~~tqafv~~d~~~d~~~IVVaFRGT~p~s~~DW~TDld~~~~~~p  223 (490)
                      +||||+++|+++|+++|+ |+|++||+|||+||++.+||+|+++|+++|++.||||||||+|+++.||+||+|++|+++|
T Consensus       172 ~aYen~~~v~~vv~~~w~-m~f~~~~~~wn~~~~~~~TqaFi~~Dk~~d~~~IVVAFRGT~p~s~~dWiTDldfs~~~~p  250 (515)
T PLN02934        172 LAYENAKVVENVVDHHWK-MHFVAFYNCWNDFQKQMSTQVFIFCDKPKDANLIVISFRGTEPFDADDWGTDFDYSWYEIP  250 (515)
T ss_pred             HHhccHHHHHHHhcccce-eeeeeehhhhhhccccCCceEEEEEccccCCceEEEEECCCCcCCHHHHhhccCccccCCC
Confidence            999999999999999999 9999999999999999999999999998888999999999999999999999999999999


Q ss_pred             CCceechhHHHHhhcCCCCCccchhhccccccccccCCCCCCCCCCCCCCCCCCCCcchhhHHHHHHHHHHHHHHhcCCc
Q 037296          224 KLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKSLLEEHKKA  303 (490)
Q Consensus       224 ~~G~VH~GF~~al~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ay~~i~~~l~~ll~~~~~~  303 (490)
                      ++|+||.||++|++++.+....+|++.++.+.+   +...+.+..      -...+..+..||+++++.++++++++|++
T Consensus       251 ~~gkVH~GF~~A~~l~~~~~~~tf~~~l~~~~~---~~~~~~~~~------~~~~~~~~~~Ay~~v~~~lk~ll~~~p~~  321 (515)
T PLN02934        251 KVGKVHMGFLEAMGLGNRDDTTTFQTSLQTKAT---SELKEEESK------KNLLEMVERSAYYAVRSKLKSLLKEHKNA  321 (515)
T ss_pred             CCCeecHHHHHHHhhhccccccchhhhhhhccc---ccccccccc------ccccccchhhHHHHHHHHHHHHHHHCCCC
Confidence            999999999999999888766778876653211   000000000      00122346789999999999999999999


Q ss_pred             eEEEeecChhhHHHHHHHHHHhhcchhhhhccceEEEEecCCccCCHHHHHHHHhhcCCCCceEEEEEECCCcCCcCCCC
Q 037296          304 KFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVYCNDMVPRLPYD  383 (490)
Q Consensus       304 kl~vTGHSLGGALA~L~a~~L~~~~~~~~~~~~~~vyTFGqPRVGd~~fa~~~~~~l~~~~~~~~RvV~~~DiVPrlP~~  383 (490)
                      +|+|||||||||||+|+|+.|..+.+.....+...+||||||||||.+|++++++.++.+..+++||||++|+|||+|++
T Consensus       322 kIvVTGHSLGGALAtLaA~~L~l~~~~~~l~~~~~vYTFGsPRVGN~~FA~~~~~~~~~~~~~~~RVVn~~DiVPrLP~~  401 (515)
T PLN02934        322 KFVVTGHSLGGALAILFPTVLVLQEETEVMKRLLGVYTFGQPRIGNRQLGKFMEAQLNYPVPRYFRVVYCNDLVPRLPYD  401 (515)
T ss_pred             eEEEeccccHHHHHHHHHHHHHHhcccccccCceEEEEeCCCCccCHHHHHHHHHhhcCCCccEEEEEECCCcccccCCC
Confidence            99999999999999999999887765554456688999999999999999999998765556899999999999999998


Q ss_pred             CCCCCeeecCeEEEecCCCcccccCCCCCCccccccccchhhhHHHHHHHHHHhhccccCCCCcchHHHHHHHHhhccCC
Q 037296          384 DKTFSYKHFGVCLFYNSCYIEQKVDEEPNKNFFGLRYLIPVYLNALWELIRSLTMGYTHGPQYEEGWFSIFARILGLAFP  463 (490)
Q Consensus       384 ~~~~~f~H~G~~v~~~s~y~~~~~~e~p~~n~~s~~~~i~~~~~a~~el~rs~~~~~~~g~~~~e~~~~~~~r~~gl~~p  463 (490)
                      +..++|+|+|+|+||++.|.++..+||||+|+|++.+.||+++||+|||+|||+++|++|++|+|||+++++|++||++|
T Consensus       402 ~~~~gY~H~G~ev~y~s~y~~~~~~eep~~n~f~~~~~i~~~~~a~wel~rs~~~~~~~g~~y~e~w~~~~~r~~gl~~p  481 (515)
T PLN02934        402 DKTFLYKHFGVCLYYDSRYFGQKMDEEPDRNPFGLRNAISAHLNAVWELWRSFIMGYTHGPEYKEGWFSIFFRIMGLVLP  481 (515)
T ss_pred             CCCcceEeCCeeEEEcCCCccccccccCCCCcccHHHHHHHHHHHHHHHHHHheeecccCcccchhHHHHHHHHHHHhcC
Confidence            77889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCChhhHHHhhhcCcccccccCCC
Q 037296          464 GISAHCPTDYVNSVRLGKERTIQMSSF  490 (490)
Q Consensus       464 gl~~H~p~~Yvna~rlg~~~~~~~~~~  490 (490)
                      ||++|+|+|||||+|||++.+.|++|+
T Consensus       482 g~~~h~p~dyvn~~rlg~~~~~~~~~~  508 (515)
T PLN02934        482 GVAAHSPTDYVNSVRLGRERVVPMSSL  508 (515)
T ss_pred             CCccCCcchhhcceeecccccccchhH
Confidence            999999999999999999999998764



>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
1usw_A260 Crystal Structure Of Ferulic Acid Esterase From Asp 3e-11
2bjh_A260 Crystal Structure Of S133a Anfaea-Ferulic Acid Comp 8e-11
1uwc_A261 Feruloyl Esterase From Aspergillus Niger Length = 2 1e-10
2hl6_A260 Structure Of Homologously Expressed Ferrulate Ester 1e-10
1dt3_A269 The Structural Origins Of Interfacial Activation In 1e-09
1gt6_A269 S146a Mutant Of Thermomyces (Humicola) Lanuginosa L 2e-09
1tic_A269 Conformational Lability Of Lipases Observed In The 2e-08
3ngm_A319 Crystal Structure Of Lipase From Gibberella Zeae Le 1e-07
5tgl_A269 A Model For Interfacial Activation In Lipases From 2e-07
4tgl_A269 Catalysis At The Interface: The Anatomy Of A Confor 2e-07
1tgl_A269 A Serine Protease Triad Forms The Catalytic Centre 2e-07
3o0d_A301 Crystal Structure Of Lip2 Lipase From Yarrowia Lipo 2e-07
1tia_A279 An Unusual Buried Polar Cluster In A Family Of Fung 1e-06
3tgl_A269 Structure And Molecular Model Refinement Of Rhizomu 2e-06
>pdb|1USW|A Chain A, Crystal Structure Of Ferulic Acid Esterase From Aspergillus Niger Length = 260 Back     alignment and structure

Iteration: 1

Score = 66.2 bits (160), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 16/129 (12%) Query: 273 NDCIPPGKMELTAYYAVKNKLKSLLEEHKKA----KFVVTGHSLGGALAILFPTVLVLHD 328 NDC G + + +V+++++SL+++ VTGHSLG ++A L Sbjct: 92 NDCEVHGGYYI-GWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAA------ 144 Query: 329 EMEIMHSLLGVYTFGQPRIGNERIGRFMKA--HLESP-VQKYFRVVYCNDMVPRLPYDDK 385 ++ + + +YTFG+PR GN+ +M + SP +YFRV + ND +P LP D+ Sbjct: 145 QLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADE 204 Query: 386 TFSYKHFGV 394 Y H GV Sbjct: 205 --GYAHGGV 211
>pdb|2BJH|A Chain A, Crystal Structure Of S133a Anfaea-Ferulic Acid Complex Length = 260 Back     alignment and structure
>pdb|1UWC|A Chain A, Feruloyl Esterase From Aspergillus Niger Length = 261 Back     alignment and structure
>pdb|2HL6|A Chain A, Structure Of Homologously Expressed Ferrulate Esterase Of Aspergillus Niger In Complex With Caps Length = 260 Back     alignment and structure
>pdb|1DT3|A Chain A, The Structural Origins Of Interfacial Activation In Thermomyces (Humicola) Lanuginosa Lipase Length = 269 Back     alignment and structure
>pdb|1GT6|A Chain A, S146a Mutant Of Thermomyces (Humicola) Lanuginosa Lipase Complex With Oleic Acid Length = 269 Back     alignment and structure
>pdb|1TIC|A Chain A, Conformational Lability Of Lipases Observed In The Absence Of An Oil-Water Interface: Crystallographic Studies Of Enzymes From The Fungi Humicola Lanuginosa And Rhizopus Delemar Length = 269 Back     alignment and structure
>pdb|3NGM|A Chain A, Crystal Structure Of Lipase From Gibberella Zeae Length = 319 Back     alignment and structure
>pdb|5TGL|A Chain A, A Model For Interfacial Activation In Lipases From The Structure Of A Fungal Lipase-Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|4TGL|A Chain A, Catalysis At The Interface: The Anatomy Of A Conformational Change In A Triglyceride Lipase Length = 269 Back     alignment and structure
>pdb|1TGL|A Chain A, A Serine Protease Triad Forms The Catalytic Centre Of A Triacylglycerol Lipase Length = 269 Back     alignment and structure
>pdb|3O0D|A Chain A, Crystal Structure Of Lip2 Lipase From Yarrowia Lipolytica At 1.7 A Resolution Length = 301 Back     alignment and structure
>pdb|1TIA|A Chain A, An Unusual Buried Polar Cluster In A Family Of Fungal Lipases Length = 279 Back     alignment and structure
>pdb|3TGL|A Chain A, Structure And Molecular Model Refinement Of Rhizomucor Miehei Triacylglyceride Lipase: A Case Study Of The Use Of Simulated Annealing In Partial Model Refinement Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 5e-41
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 2e-39
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 2e-39
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 3e-38
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 1e-37
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 1e-36
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 4e-36
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 4e-36
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 9e-36
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 2e-35
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 4e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419 Back     alignment and structure
 Score =  151 bits (382), Expect = 5e-41
 Identities = 49/281 (17%), Positives = 86/281 (30%), Gaps = 64/281 (22%)

Query: 139 IMASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATL--- 195
           I      Y+  + +      H     F+ F      + KE +   ++     +   L   
Sbjct: 88  IAHPYTKYKVTKFIYATSDIHVP-ESFLLFPISREGWSKESNWMGYVAVTDDQGTALLGR 146

Query: 196 --ILISFRGTEPFDADDWCTDFDYSWYEIPKL-------GKVHMGFLEALGLGNRADTVT 246
             I++S+RG+      +W  DF++      K+        ++H G+       +     T
Sbjct: 147 RDIVVSWRGSVQPL--EWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYMSQDERSPFT 204

Query: 247 FQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKSLLEEHK--KAK 304
             N                                   A   V  ++  LLE++K  +  
Sbjct: 205 KTN-----------------------------------ARDQVLREVGRLLEKYKDEEVS 229

Query: 305 FVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLG-----VYTFGQPRIGNERIGRFMKAH 359
             + GHSLG ALA L  T +V +                 + F  PR+G+     F K  
Sbjct: 230 ITICGHSLGAALATLSATDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDS---DFRKLF 286

Query: 360 LESPVQKYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNS 400
                 +  R     D++P  P       Y   G     ++
Sbjct: 287 SGLEDIRVLRTRNLPDVIPIYPP----IGYSEVGDEFPIDT 323


>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 100.0
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 100.0
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 100.0
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 100.0
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 100.0
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 100.0
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 100.0
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 100.0
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 100.0
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 100.0
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 99.96
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 97.45
2z8x_A 617 Lipase; beta roll, calcium binding protein, RTX pr 96.66
3lp5_A250 Putative cell surface hydrolase; structural genom 96.32
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 96.24
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 96.18
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 96.06
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 96.03
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 96.02
3h04_A275 Uncharacterized protein; protein with unknown func 96.01
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 95.9
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.8
4fle_A202 Esterase; structural genomics, PSI-biology, northe 95.75
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 95.65
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.59
3llc_A270 Putative hydrolase; structural genomics, joint cen 95.53
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.5
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 95.48
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 95.37
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 95.37
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 95.29
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 95.29
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 95.29
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 95.24
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 95.21
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 95.19
1iup_A282 META-cleavage product hydrolase; aromatic compound 95.19
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.17
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 95.16
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 95.14
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 95.13
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 95.12
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 95.1
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 95.07
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 95.07
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.06
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 95.05
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 95.05
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 94.99
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 94.99
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 94.99
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 94.97
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 94.95
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 94.93
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 94.92
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.91
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.91
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 94.91
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 94.9
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 94.88
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 94.84
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 94.84
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 94.84
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 94.79
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 94.78
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 94.77
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 94.76
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 94.74
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 94.74
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 94.74
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.71
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 94.7
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 94.7
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 94.7
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 94.69
1vkh_A273 Putative serine hydrolase; structural genomics, jo 94.68
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 94.68
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 94.67
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 94.66
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 94.65
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 94.64
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 94.64
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 94.63
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 94.62
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 94.62
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 94.59
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 94.55
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 94.48
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 94.48
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 94.44
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 94.44
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 94.43
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.4
1r3d_A264 Conserved hypothetical protein VC1974; structural 94.39
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 94.38
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.38
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 94.37
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 94.35
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 94.34
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 94.3
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 94.3
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 94.26
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 94.26
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 94.23
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 94.2
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 94.2
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 94.19
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 94.19
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 94.18
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 94.14
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 94.12
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 94.09
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 93.99
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 93.99
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 93.96
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 93.95
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 93.93
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 93.89
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 93.85
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 93.83
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 93.81
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 93.81
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 93.78
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 93.75
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 93.65
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 93.6
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 93.56
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 93.55
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 93.51
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 93.46
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 93.38
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 93.37
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 93.36
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 93.3
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.3
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 93.29
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 93.26
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 93.23
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 93.22
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 93.12
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 92.98
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 92.79
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 92.77
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 92.76
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 92.73
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 92.66
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 92.62
1kez_A300 Erythronolide synthase; polyketide synthase, modul 92.56
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 92.49
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 92.46
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 92.36
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 92.34
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 92.31
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 92.3
3tej_A329 Enterobactin synthase component F; nonribosomal pe 92.3
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 92.22
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 92.2
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 92.13
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 92.11
3ain_A323 303AA long hypothetical esterase; carboxylesterase 92.07
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 92.06
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 92.05
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 92.03
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 91.86
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 91.83
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 91.7
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 91.69
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 91.68
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 91.54
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 91.41
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 90.73
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 91.38
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 91.37
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 91.35
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 91.28
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 91.22
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 91.15
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 91.08
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 91.07
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 90.98
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 90.82
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 90.72
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 90.7
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 90.61
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 90.6
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 90.59
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 90.57
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 90.56
3bjr_A283 Putative carboxylesterase; structural genomics, jo 90.54
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 90.54
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 90.53
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 90.52
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 90.52
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 90.5
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 90.5
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 90.4
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 90.2
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 89.96
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 89.87
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 89.76
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 89.73
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 89.46
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 89.38
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 89.31
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 89.17
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 89.17
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 89.1
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 89.08
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 88.63
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 88.49
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 88.31
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 87.87
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 87.8
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 87.21
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 86.82
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 86.15
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 86.08
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 85.8
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 85.36
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 85.28
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 84.62
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 84.51
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 84.48
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 84.37
3nuz_A398 Putative acetyl xylan esterase; structural genomic 83.97
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 81.71
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 81.48
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
Probab=100.00  E-value=1.3e-39  Score=322.69  Aligned_cols=216  Identities=19%  Similarity=0.221  Sum_probs=167.3

Q ss_pred             HHHHHhccChHhHhhhhhcccceeeeeecccccccCcCccCeEEEEEEEcCCCCCeEEEEEcCCCcCChhcHHhhccccc
Q 037296          140 MASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSW  219 (490)
Q Consensus       140 mASklAYen~~~i~~~v~~~W~~~~~v~~~~~~n~~~~~~~tqafv~~d~~~d~~~IVVaFRGT~p~s~~DW~TDld~~~  219 (490)
                      .-|.+||.+-.      .+... ++.+..++     ....++++||+.|+  +.+.|||+||||.  +..||++|+++.+
T Consensus        16 ~~s~aAY~~c~------~~~~~-~~iv~~f~-----~~~~d~~gyva~d~--~~~~IvVafRGT~--s~~dw~~Dl~~~~   79 (258)
T 3g7n_A           16 KLSSAAYTGCI------GKAFD-VTIVKRIY-----DLVTDTNGFVGYST--EKKTIAVIMRGST--TITDFVNDIDIAL   79 (258)
T ss_dssp             HHHHHHHHTCS------SEETT-EEEEEEEE-----ETTTTEEEEEEEET--TTTEEEEEECCCS--CCCC----CCCCE
T ss_pred             HHHHHhhCCCC------CCCCC-cEEEEEEe-----cCCCCceEEEEEEC--CCCEEEEEECCCC--CHHHHHHhcccce
Confidence            34667887521      12222 55555443     24678999999998  5689999999999  8999999999887


Q ss_pred             ccc-------CCCceechhHHHHhhcCCCCCccchhhccccccccccCCCCCCCCCCCCCCCCCCCCcchhhHHHHHHHH
Q 037296          220 YEI-------PKLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNK  292 (490)
Q Consensus       220 ~~~-------p~~G~VH~GF~~al~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ay~~i~~~  292 (490)
                      ++.       +..++||.||++++..                                              .+.++.+.
T Consensus        80 ~~~~~~g~~~~~~~~VH~GF~~~~~~----------------------------------------------~~~~~~~~  113 (258)
T 3g7n_A           80 ITPELSGVTFPSDVKIMRGVHRPWSA----------------------------------------------VHDTIITE  113 (258)
T ss_dssp             ECCCCTTCCCCTTCCEEHHHHHHHHH----------------------------------------------HHHHHHHH
T ss_pred             eccccCCCcCCCCcEEehhHHHHHHH----------------------------------------------HHHHHHHH
Confidence            652       3567999999998742                                              24467888


Q ss_pred             HHHHHHhcCCceEEEeecChhhHHHHHHHHHHhhcchhhhhccceEEEEecCCccCCHHHHHHHHhhcCCCCceEEEEEE
Q 037296          293 LKSLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLESPVQKYFRVVY  372 (490)
Q Consensus       293 l~~ll~~~~~~kl~vTGHSLGGALA~L~a~~L~~~~~~~~~~~~~~vyTFGqPRVGd~~fa~~~~~~l~~~~~~~~RvV~  372 (490)
                      ++++++++|+++|++||||||||||+|+++++....+    ...+.+||||+|||||++|++++++..    .+++||||
T Consensus       114 l~~~~~~~p~~~i~vtGHSLGGalA~l~a~~l~~~~~----~~~v~~~tFg~PrvGn~~fa~~~~~~~----~~~~Rvvn  185 (258)
T 3g7n_A          114 VKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFP----DKSLVSNALNAFPIGNQAWADFGTAQA----GTFNRGNN  185 (258)
T ss_dssp             HHHHHHHSTTCEEEEEEETHHHHHHHHHHHHHHHHCT----TSCEEEEEESCCCCBCHHHHHHHHHSS----SEEEEEEE
T ss_pred             HHHHHHhCCCCeEEEeccCHHHHHHHHHHHHHHHhCC----CCceeEEEecCCCCCCHHHHHHHHhcC----CCeEEEEe
Confidence            9999999999999999999999999999999876533    245789999999999999999999864    38999999


Q ss_pred             CCCcCCcCCCCCCCCCeeecCeEEEecCC---CcccccCCCCCCcccc-ccccchhhh
Q 037296          373 CNDMVPRLPYDDKTFSYKHFGVCLFYNSC---YIEQKVDEEPNKNFFG-LRYLIPVYL  426 (490)
Q Consensus       373 ~~DiVPrlP~~~~~~~f~H~G~~v~~~s~---y~~~~~~e~p~~n~~s-~~~~i~~~~  426 (490)
                      .+|+||+||+. ..++|+|+|+|+|+++.   |..|...|+|+|+.-. ....+++|+
T Consensus       186 ~~D~VP~lPp~-~~~gy~H~g~e~~~~~~~~~~~~C~~~ed~~Cs~~~~~~~~~~dH~  242 (258)
T 3g7n_A          186 VLDGVPNMYSS-PLVNFKHYGTEYYSSGTEASTVKCEGQRDKSCSAGNGMYAVTPGHI  242 (258)
T ss_dssp             TTCBGGGTTCS-TTTCCBCCSEEEEESSSSTTCEECSSSSCTTTGGGSCCCBSCGGGG
T ss_pred             CCCccCcCCCC-CCcCCEecceEEEECCCCceEEEeCCCCCCCccCcCCCCCcchHHH
Confidence            99999999983 26899999999999853   5667778999997532 234566664



>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 490
d1uwca_261 c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni 4e-23
d3tgla_265 c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor 5e-22
d1lgya_265 c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus ni 1e-21
d1tiba_269 c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces 2e-19
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Feruloyl esterase A
species: Aspergillus niger [TaxId: 5061]
 Score = 96.0 bits (238), Expect = 4e-23
 Identities = 65/295 (22%), Positives = 99/295 (33%), Gaps = 84/295 (28%)

Query: 123 SGIEMELVNRILMDLCIMA--SKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMS 180
            GI  +L NR    L  MA  S+ AY +   + + ++   K       YN   D      
Sbjct: 4   QGISEDLYNR----LVEMATISQAAYADLCNIPSTIIKGEK------IYNAQTD------ 47

Query: 181 TQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSWYEIPKL-----GKVHMGFLEA 235
              +IL D       I+  FRGT      +   D +Y+      L      +VH G+   
Sbjct: 48  INGWILRDDTSKE--IITVFRGTGSDT--NLQLDTNYTLTPFDTLPQCNDCEVHGGYYIG 103

Query: 236 LGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLKS 295
                                                          ++    V++ +K 
Sbjct: 104 W----------------------------------------------ISVQDQVESLVKQ 117

Query: 296 LLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRF 355
              ++      VTGHSLG ++A L    L    +   +      YTFG+PR GN+    +
Sbjct: 118 QASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRL------YTFGEPRSGNQAFASY 171

Query: 356 MKAHLESPVQ---KYFRVVYCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYIEQKV 407
           M    +       +YFRV + ND +P LP  +    Y H GV  +    Y  Q  
Sbjct: 172 MNDAFQVSSPETTQYFRVTHSNDGIPNLPPAE--QGYAHGGVEYWSVDPYSAQNT 224


>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Length = 265 Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Length = 265 Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 100.0
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 100.0
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 100.0
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 100.0
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 100.0
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 97.26
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.64
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 96.11
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 95.74
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 95.52
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 95.42
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.29
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 95.17
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 94.93
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.81
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 94.8
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 94.67
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 94.64
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 94.43
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 94.0
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.83
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 93.82
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 93.73
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 93.72
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 93.67
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 93.62
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 93.58
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 93.52
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 93.51
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 93.45
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.39
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 93.34
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 93.29
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 93.21
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 92.53
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 92.41
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 92.39
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 92.34
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 92.15
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 91.98
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 91.69
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 91.3
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 90.73
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 89.6
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 89.24
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 89.1
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 88.08
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 87.54
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 86.98
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 86.95
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 86.78
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 85.69
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 85.63
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 85.5
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 82.72
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 82.32
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 81.35
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 81.23
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Feruloyl esterase A
species: Aspergillus niger [TaxId: 5061]
Probab=100.00  E-value=1.4e-40  Score=327.62  Aligned_cols=194  Identities=26%  Similarity=0.397  Sum_probs=157.3

Q ss_pred             HHHHHhccChHhHhhhhhcccceeeeeecccccccCcCccCeEEEEEEEcCCCCCeEEEEEcCCCcCChhcHHhhccccc
Q 037296          140 MASKLAYENAEVVRNVVVDHWKQMHFVDFYNCWNDFEKEMSTQVFILTDKPKDATLILISFRGTEPFDADDWCTDFDYSW  219 (490)
Q Consensus       140 mASklAYen~~~i~~~v~~~W~~~~~v~~~~~~n~~~~~~~tqafv~~d~~~d~~~IVVaFRGT~p~s~~DW~TDld~~~  219 (490)
                      ..|++||.+.......+      +....+      +....++|+||+.|+  +.+.|||+||||.  +..||++|+++..
T Consensus        19 ~ls~~aY~~~~~~~~~~------~~~~~~------~~~~~d~~gyv~~d~--~~k~ivVafRGT~--s~~d~~~Dl~~~~   82 (261)
T d1uwca_          19 TISQAAYADLCNIPSTI------IKGEKI------YNAQTDINGWILRDD--TSKEIITVFRGTG--SDTNLQLDTNYTL   82 (261)
T ss_dssp             HHHHHTTTTTTTCCTTE------EEEEEE------EETTTTEEEEEEEET--TTTEEEEEECCCC--SHHHHHHHTCCCE
T ss_pred             HHHHHHhCcccCCCCcc------ccceeE------EeccCCcEEEEEEEC--CCCeEEEEEcCCC--CHHHHHHhcCcce
Confidence            45789998864332211      111122      234567899999998  4689999999999  8999999999988


Q ss_pred             cccC-----CCceechhHHHHhhcCCCCCccchhhccccccccccCCCCCCCCCCCCCCCCCCCCcchhhHHHHHHHHHH
Q 037296          220 YEIP-----KLGKVHMGFLEALGLGNRADTVTFQNHLLGKEAKFRDRSSDSEELPSTGNDCIPPGKMELTAYYAVKNKLK  294 (490)
Q Consensus       220 ~~~p-----~~G~VH~GF~~al~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ay~~i~~~l~  294 (490)
                      .+++     +.++||.||++++..                                              .+.++.+.++
T Consensus        83 ~~~~~~~~~~~~~vH~GF~~~~~~----------------------------------------------i~~~i~~~i~  116 (261)
T d1uwca_          83 TPFDTLPQCNDCEVHGGYYIGWIS----------------------------------------------VQDQVESLVK  116 (261)
T ss_dssp             EECTTCTTSTTCEEEHHHHHHHHH----------------------------------------------HHHHHHHHHH
T ss_pred             EeccccCCCCCeEEeHHHHHHHHH----------------------------------------------HHHHHHHHHH
Confidence            7653     246999999998752                                              2346788889


Q ss_pred             HHHHhcCCceEEEeecChhhHHHHHHHHHHhhcchhhhhccceEEEEecCCccCCHHHHHHHHhhcCC---CCceEEEEE
Q 037296          295 SLLEEHKKAKFVVTGHSLGGALAILFPTVLVLHDEMEIMHSLLGVYTFGQPRIGNERIGRFMKAHLES---PVQKYFRVV  371 (490)
Q Consensus       295 ~ll~~~~~~kl~vTGHSLGGALA~L~a~~L~~~~~~~~~~~~~~vyTFGqPRVGd~~fa~~~~~~l~~---~~~~~~RvV  371 (490)
                      ++++++|+++|++||||||||||+|++++|....+      .+.+||||+|||||.+|++++++.+..   ...+++|||
T Consensus       117 ~~~~~~~~~~i~vTGHSLGGAlA~L~a~~l~~~~~------~~~~~tFG~PrvGn~~fa~~~~~~~~~~~~~~~~~~Rvv  190 (261)
T d1uwca_         117 QQASQYPDYALTVTGHSLGASMAALTAAQLSATYD------NVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVT  190 (261)
T ss_dssp             HHHHHSTTSEEEEEEETHHHHHHHHHHHHHHTTCS------SEEEEEESCCCCBCHHHHHHHHHHTTTTCTTTCSEEEEE
T ss_pred             HHHhhCCCcceEEeccchhHHHHHHHHHHHHhcCC------CcceEEecCccccCHHHHHHHHhhcccccccCccEEEEE
Confidence            99999999999999999999999999999987653      368999999999999999999987642   245799999


Q ss_pred             ECCCcCCcCCCCCCCCCeeecCeEEEecCCCc
Q 037296          372 YCNDMVPRLPYDDKTFSYKHFGVCLFYNSCYI  403 (490)
Q Consensus       372 ~~~DiVPrlP~~~~~~~f~H~G~~v~~~s~y~  403 (490)
                      |.+|+|||||+.  .++|.|+|.|+||++.+.
T Consensus       191 ~~~D~VP~lP~~--~~gy~H~g~Evw~~~~~~  220 (261)
T d1uwca_         191 HSNDGIPNLPPA--EQGYAHGGVEYWSVDPYS  220 (261)
T ss_dssp             ETTCSGGGCSCG--GGTCBCCSEEEEECSSCS
T ss_pred             eCCCeEEECCCC--CCCCEeCCeEEEeCCCCC
Confidence            999999999997  688999999999987644



>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure