Citrus Sinensis ID: 037315

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---

MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENERDDNLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS

cccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccCCcccccccccccccccEEEccccccccccccccccccccccEEEcccccccCCccHHHHHccccccEEEcccccccCCccccccccccccEEEccccCEEECccccHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccCECccccccccccccEEEccccCEECcccccccccccccEEEcccccccccccccHcccccccEEEccccCECccccccHcccccccEEEccccccCECcccccccccccEEEccccccCCcccHHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEEEEcccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHHHcc

MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNN*SSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRS***************NLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FT3, chain A
Confidence level:very confident
Coverage over the Query: 219-354,376-457,511-591
View the alignment between query and template
View the model in PyMOL

Template: 2FT3, chain A
Confidence level:very confident
Coverage over the Query: 170-305,328-457
View the alignment between query and template
View the model in PyMOL

Template: 3O6N, chain A
Confidence level:very confident
Coverage over the Query: 218-457,511-625
View the alignment between query and template
View the model in PyMOL

Template: 2V9T, chain B
Confidence level:very confident
Coverage over the Query: 390-457,511-649
View the alignment between query and template
View the model in PyMOL

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 118-355,382-457,511-575
View the alignment between query and template
View the model in PyMOL

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 19-80,109-457,511-626
View the alignment between query and template
View the model in PyMOL

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 1-460,506-611
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 1-633
View the alignment between query and template
View the model in PyMOL