Citrus Sinensis ID: 037315


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENERDDNLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
cccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccEEcccccccccccccccEEEccccccccccccccccccccccEEEcccccccEEccHHHHHccccccEEEcccccccEEccccccccccccEEEccccEEEEEccccHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccccHHccccccEEEccccEEEccccccHHccccccEEEccccccEEEcccccccccccEEEccccccEEcccHHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEEEEcccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHHHcc
cccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHHccccccccEEEEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEEccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEccccccccccccccccHHccccccHEEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccccccccHHcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcc
madnelrgslpwclanmtslrildvssnqltgsisssplfyLTSIEelslsnnhfhipisleplfnhsrlkifyadnnpinakitkshtlttpkfQLASlslsssygdgvtfpkflyyqhdledvhfsriqmngefpnwllenntkLRQLSLvndslagpfrlpihshrhlrlldvsnnnfqghipveigdILPRLISFNismnaldgsipssfgnmNLLQILDlsnnqltgeipehlamgCVNLEFLALSNnslkghmfsrnfNLINLRWLQLegnhfvgeipqslskcssleglylnnnslsgkiprwlgNLTWLIHIImpknhlegpipvefchlyslqildisdnnisgslpscfhplsitqvhlsknmlhgqlkggtffncsslvTLDLsynllngsipdwiDGLSQLSHLIlgnnnlegevpvqlcglnqlqlldlsnnnlhglippcfdntklhesynnssspdeQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSgldlscnklighippqvgnltrIQTLNlshnnltglipstfsnlKQIESLDLSYnklngkiphQLVELKELAVFSVAYNnlsgeipeWKAQFATFnensyegntflcglplpicrspttmseasienerddnlidtdsffITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
madnelrgslPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENERDDNLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVqlcglnqlqlldlsnnnlHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENERDDNLidtdsffitfttsYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
********SLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKL*************FKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRS***************NLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWI**
MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNN*SSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCG****************************DSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENERDDNLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
**DNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENERDDNLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENERDDNLIDTDSFFITFTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.900 0.498 0.312 1e-68
Q9ZPS9 1143 Serine/threonine-protein no no 0.810 0.491 0.320 5e-59
Q9LJF3 1164 Receptor-like protein kin no no 0.906 0.539 0.308 1e-58
Q9FL28 1173 LRR receptor-like serine/ no no 0.822 0.485 0.319 2e-58
C0LGQ5 1249 LRR receptor-like serine/ no no 0.826 0.458 0.319 2e-57
Q9ZWC8 1166 Serine/threonine-protein no no 0.920 0.547 0.294 3e-57
Q9LHP4 1141 Receptor-like protein kin no no 0.851 0.517 0.322 5e-57
P93194 1109 Receptor-like protein kin N/A no 0.744 0.465 0.321 8e-56
Q9LYN8 1192 Leucine-rich repeat recep no no 0.864 0.502 0.301 3e-54
O22476 1196 Protein BRASSINOSTEROID I no no 0.890 0.515 0.283 8e-53
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  261 bits (667), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 215/688 (31%), Positives = 337/688 (48%), Gaps = 64/688 (9%)

Query: 1   MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHF--HIP 58
           + DNEL G +P  + N TSL +   + N+L GS+ +  L  L +++ L+L +N F   IP
Sbjct: 199 LQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAE-LNRLKNLQTLNLGDNSFSGEIP 257

Query: 59  ISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYY 118
             L  L +   L +     N +   I K     T    L +L LSS+   GV   +F + 
Sbjct: 258 SQLGDLVSIQYLNLI---GNQLQGLIPKR---LTELANLQTLDLSSNNLTGVIHEEF-WR 310

Query: 119 QHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSN 178
            + LE +  ++ +++G  P  +  NNT L+QL L    L+G     I + + L+LLD+SN
Sbjct: 311 MNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSN 370

Query: 179 NNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHL 238
           N   G IP  +  ++  L +  ++ N+L+G++ SS  N+  LQ   L +N L G++P+ +
Sbjct: 371 NTLTGQIPDSLFQLV-ELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEI 429

Query: 239 AMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYL 298
                 LE + L  N   G M     N   L+ +   GN   GEIP S+ +   L  L+L
Sbjct: 430 GF-LGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHL 488

Query: 299 NNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSC 358
             N L G IP  LGN   +  I +  N L G IP  F  L +L++  I +N++ G+LP  
Sbjct: 489 RENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDS 548

Query: 359 FHPLS-ITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLI 417
              L  +T+++ S N  +G +        SS ++ D++ N   G IP  +   + L  L 
Sbjct: 549 LINLKNLTRINFSSNKFNGSIS--PLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLR 606

Query: 418 LGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIP------------------------- 452
           LG N   G +P     +++L LLD+S N+L G+IP                         
Sbjct: 607 LGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPT 666

Query: 453 -----PCFDNTKLHESYNNSSSPDEQFKI-----LFSIKGHQ--GHVEKKIQEFFEFTTK 500
                P     KL  +    S P E F +     LF + G+   G + ++I         
Sbjct: 667 WLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLF-LDGNSLNGSIPQEIGNLQALNAL 725

Query: 501 NIAY-IFQGKV------LSLLSGLDLSCNKLIGHIPPQVGNLTRIQT-LNLSHNNLTGLI 552
           N+      G +      LS L  L LS N L G IP ++G L  +Q+ L+LS+NN TG I
Sbjct: 726 NLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRI 785

Query: 553 PSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNE 612
           PST S L ++ESLDLS+N+L G++P Q+ ++K L   +++YNNL G++   K QF+ +  
Sbjct: 786 PSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKL---KKQFSRWQA 842

Query: 613 NSYEGNTFLCGLPLPICRSPTTMSEASI 640
           +++ GN  LCG PL  C    + ++ S+
Sbjct: 843 DAFVGNAGLCGSPLSHCNRAGSKNQRSL 870




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
255581263 912 serine-threonine protein kinase, plant-t 0.974 0.740 0.522 0.0
224123984 1016 predicted protein [Populus trichocarpa] 0.991 0.676 0.481 1e-161
224142481781 predicted protein [Populus trichocarpa] 0.943 0.837 0.480 1e-159
224073382 1309 predicted protein [Populus trichocarpa] 0.987 0.522 0.467 1e-156
224073436 1014 predicted protein [Populus trichocarpa] 0.991 0.677 0.465 1e-156
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.979 0.463 0.462 1e-155
224134891 953 predicted protein [Populus trichocarpa] 0.989 0.719 0.462 1e-153
224073422 969 predicted protein [Populus trichocarpa] 0.976 0.698 0.464 1e-152
224073452710 predicted protein [Populus trichocarpa] 0.965 0.942 0.466 1e-149
224098008 1097 predicted protein [Populus trichocarpa] 0.945 0.597 0.468 1e-148
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/696 (52%), Positives = 475/696 (68%), Gaps = 21/696 (3%)

Query: 1   MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPIS 60
           ++ NE  G LPWCL+N+TSL++LD+SSNQ  G IS+SPL  L S+ +L +SNNHF +P S
Sbjct: 234 VSSNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPFS 293

Query: 61  LEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQH 120
           L P FNHS LK     NN I     ++   + P+FQL S+ + S YG   TFP FLY+Q+
Sbjct: 294 LGPFFNHSNLKHIRGQNNAI---YLEAELHSAPRFQLISI-IFSGYGICGTFPNFLYHQN 349

Query: 121 DLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNN 180
           +L+ V  S + + GEFPNWLL NNT+L  L LVN+SL+G  +LP+H H +L  LD+SNN+
Sbjct: 350 NLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNNH 409

Query: 181 FQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAM 240
              HIP+EIG  LP+L   N+S N  DGSIPSSFGNMN L+ILDLSNNQL+G IPEHLA 
Sbjct: 410 VHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLAT 469

Query: 241 GCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNN 300
           GC +L  L LSNNSL+G MFS+ FNL NL WL+L+ NHF G IP+SLSK S+L  + L++
Sbjct: 470 GCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK-SALSIMDLSD 528

Query: 301 NSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFH 360
           N LSG IP W+GNL++L ++I+  N L+GPIPVEFC L+ L++LD+++N++SG LPSC  
Sbjct: 529 NHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCLS 588

Query: 361 PLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGN 420
           P SI  VHLS+NM+ G      F     LVTLDLS N + G IP  I G++ L  L L +
Sbjct: 589 PSSIIHVHLSQNMIEGPWTNA-FSGSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKS 647

Query: 421 NNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSI 480
           N  +GE+P Q+CGL QL L+ L++NNL G IP C     L    ++S +PD         
Sbjct: 648 NRFDGEIPAQICGLYQLSLIVLADNNLSGSIPSC-----LQLDQSDSLAPDVPPVPNPLN 702

Query: 481 KGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQT 540
             +       ++  + FTTK  +Y +QGK+LS +SG+D SCNKL G IPP++GN + I +
Sbjct: 703 PYYL-----PVRPMY-FTTKRRSYSYQGKILSYISGIDFSCNKLTGEIPPEMGNHSAIYS 756

Query: 541 LNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEI 600
           LNLS+N  TG IPSTFSNLKQIESLDLSYN LNG IP QL+ELK L+ FSVA+NNL G+ 
Sbjct: 757 LNLSYNRFTGPIPSTFSNLKQIESLDLSYNNLNGDIPSQLLELKFLSYFSVAHNNLFGKT 816

Query: 601 PEWKAQFATFNENSYEGNTFLCGLPLPIC---RSPTTMSEASIENERDDNLIDTDSFFIT 657
           P+   QFATF  +SYEGN  LCGLPLP     R  ++   AS  +E + N +D ++F+ +
Sbjct: 817 PKRTGQFATFEVSSYEGNPNLCGLPLPKSCTEREASSAPRASAMDE-ESNFLDMNTFYGS 875

Query: 658 FTTSYVIVIFGIVTVLYVNSYWRHRWFYFVEMWITS 693
           F  SY  VI G+  VLY+N  WR  WF FV++ I+S
Sbjct: 876 FIVSYTFVIIGMFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073452|ref|XP_002304097.1| predicted protein [Populus trichocarpa] gi|222841529|gb|EEE79076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.976 0.677 0.376 1.8e-110
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.975 0.692 0.376 2e-102
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.888 0.568 0.379 3.1e-99
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.974 0.757 0.353 2e-97
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.974 0.721 0.340 6e-87
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.968 0.738 0.323 6e-80
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.903 0.648 0.336 3.3e-79
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.880 0.520 0.307 4.5e-61
TAIR|locus:2041150 1143 BRL2 "BRI1-like 2" [Arabidopsi 0.893 0.541 0.308 1.8e-60
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.906 0.774 0.297 6.4e-60
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1091 (389.1 bits), Expect = 1.8e-110, P = 1.8e-110
 Identities = 266/707 (37%), Positives = 379/707 (53%)

Query:     1 MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPIS 60
             +++N+L G  P CL ++T LR+LD+SSNQLTG++ S+ L  L S+E LSL  N+F    S
Sbjct:   265 LSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSA-LANLESLEYLSLFGNNFEGFFS 323

Query:    61 LEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQH 120
             L  L N S+LK+   D+   N+   +  T   PKFQL  ++L S   + V  P FL +Q 
Sbjct:   324 LGLLANLSKLKVLRLDSQS-NSLEVEFETSWKPKFQLVVIALRSCNLEKV--PHFLLHQK 380

Query:   121 DLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNN 180
             DL  V  S  Q++G FP+WLLENNTKL  L L N+S    F+LP  +H +L  L+VS N 
Sbjct:   381 DLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTS-FQLPKSAH-NLLFLNVSVNK 438

Query:   181 FQGHIPVE-IGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLA 239
             F  H+ ++  G ILP L+  N++ N   G++PSS  NM  ++ LDLS+N+  G++P    
Sbjct:   439 FN-HLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFL 497

Query:   240 MGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLN 299
              GC NL  L LS+N L G +F    N   L  + ++ N F G I +      SL  L ++
Sbjct:   498 KGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDIS 557

Query:   300 NNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCF 359
             NN L+G IP W+G    L  + +  N LEG IP    ++  LQ+LD+S N +SG +P   
Sbjct:   558 NNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPP-- 615

Query:   360 HPLSITQ---VHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHL 416
             H  SI     + L  N L G +      N   ++ LDL  N L+G++P++I+    +S L
Sbjct:   616 HVSSIYHGAVLLLQNNNLSGVIPDTLLLN---VIVLDLRNNRLSGNLPEFIN-TQNISIL 671

Query:   417 ILGNNNLEGEVPVXXXXXXXXXXXXXXXXXXHGLIPPCFDNT-----KLHESYN------ 465
             +L  NN  G++P                   +G IP C  NT     K  +SY       
Sbjct:   672 LLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSR 731

Query:   466 -NSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKL 524
               ++     F+ L  I       E   Q   EF TK+    + G  L LL G+DLS N+L
Sbjct:   732 FGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENEL 791

Query:   525 IGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELK 584
              G IP ++G L  ++ LNLSHNNL+G+I  +FS LK +ESLDLS+N+L G IP QL ++ 
Sbjct:   792 SGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMI 851

Query:   585 ELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLPLPICRSPTTMSEASIENER 644
              LAVF+V+YNNLSG +P+ + QF TF   SY GN  LCG  + I  +           E 
Sbjct:   852 SLAVFNVSYNNLSGIVPQGR-QFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEA 910

Query:   645 DDNLXXXXXXXXXXXXXYVIVIFGIVTVLYVNSYWRHRWFYFVEMWI 691
             D++              YV ++ GI+  L  +S W   WFY V+ ++
Sbjct:   911 DESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAWFYIVDAFV 957


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041150 BRL2 "BRI1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01330121
hypothetical protein (1016 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-62
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-57
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-47
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  223 bits (569), Expect = 5e-62
 Identities = 173/543 (31%), Positives = 262/543 (48%), Gaps = 51/543 (9%)

Query: 122 LEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNF 181
           ++ ++ S  Q++G  P+ +   ++ LR L+L N++  G   +P  S  +L  LD+SNN  
Sbjct: 95  IQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGS--IPRGSIPNLETLDLSNNML 152

Query: 182 QGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMG 241
            G IP +IG     L   ++  N L G IP+S  N+  L+ L L++NQL G+IP  L   
Sbjct: 153 SGEIPNDIG-SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQ- 210

Query: 242 CVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNN 301
             +L+++ L  N+L G +      L +L  L L  N+  G IP SL    +L+ L+L  N
Sbjct: 211 MKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQN 270

Query: 302 SLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHP 361
            LSG IP  + +L  LI + +  N L G IP     L +L+IL +  NN +G +P     
Sbjct: 271 KLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS 330

Query: 362 LSITQV-HLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGN 420
           L   QV  L  N   G++        ++L  LDLS N L G IP+ +     L  LIL +
Sbjct: 331 LPRLQVLQLWSNKFSGEIPK-NLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFS 389

Query: 421 NNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSI 480
           N+LEGE+P  L     L+ + L +N+  G +P  F  TKL   Y           +  S 
Sbjct: 390 NSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF--TKLPLVYF----------LDISN 437

Query: 481 KGHQGHVEKKIQEFFEFTTKNIAY-IFQGKVLSL-----LSGLDLSCNKLIGHIPPQVGN 534
              QG +  +  +       ++A   F G +        L  LDLS N+  G +P ++G+
Sbjct: 438 NNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGS 497

Query: 535 LTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYN 594
           L+ +  L LS N L+G IP   S+ K++ SLDLS+N+L+G+IP    E+  L+   ++ N
Sbjct: 498 LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQN 557

Query: 595 NLSGEIPE-----------------------WKAQFATFNENSYEGNTFLCG----LPLP 627
            LSGEIP+                           F   N ++  GN  LCG      LP
Sbjct: 558 QLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLP 617

Query: 628 ICR 630
            C+
Sbjct: 618 PCK 620


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PLN03150623 hypothetical protein; Provisional 99.5
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.04
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.02
PLN03150623 hypothetical protein; Provisional 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.39
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.19
KOG4341483 consensus F-box protein containing LRR [General fu 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.13
KOG4341483 consensus F-box protein containing LRR [General fu 98.1
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.75
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.74
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.73
PRK15386426 type III secretion protein GogB; Provisional 97.62
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.67
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.66
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.57
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.28
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.77
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.49
smart0037026 LRR Leucine-rich repeats, outliers. 93.62
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.62
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.57
smart0037026 LRR Leucine-rich repeats, outliers. 92.57
KOG4308478 consensus LRR-containing protein [Function unknown 92.32
KOG4308478 consensus LRR-containing protein [Function unknown 91.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.58
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 89.26
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.95
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.31
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.41
KOG0473 326 consensus Leucine-rich repeat protein [Function un 84.7
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.27
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3e-62  Score=571.94  Aligned_cols=543  Identities=33%  Similarity=0.494  Sum_probs=499.0

Q ss_pred             CCCCCEEECCCCCCCCcCCccccCCCCCCCEEECCCCcCcCcCCcccccCCCCCcEEEccCCccccccccccCCCCCCcc
Q 037315           17 MTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQ   96 (693)
Q Consensus        17 l~~L~~L~Ls~n~l~~~l~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~~   96 (693)
                      ..+++.|||++|.+++.++. .+..+++|++|+|++|++.+.+|...+..+++|++|++++|.+++..+..     ...+
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~-~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~-----~l~~  141 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISS-AIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG-----SIPN  141 (968)
T ss_pred             CCcEEEEEecCCCccccCCh-HHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCcc-----ccCC
Confidence            35799999999999877776 89999999999999999988888666668999999999999988765542     2348


Q ss_pred             ccEEecCCCCCCCCcCchhhcCCCCCCEEEccCccccccCchhhhhcCCCCCEEEccCCcccccCCCCCCCCCCCCEEEc
Q 037315           97 LASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDV  176 (693)
Q Consensus        97 L~~L~L~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l  176 (693)
                      |++|++ +.+.+.+..|..++.+++|++|++++|.+.+.+|..+ +++++|++|++++|.+.+..+..++.+++|++|++
T Consensus       142 L~~L~L-s~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  219 (968)
T PLN00113        142 LETLDL-SNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYL  219 (968)
T ss_pred             CCEEEC-cCCcccccCChHHhcCCCCCEEECccCcccccCChhh-hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEEC
Confidence            999999 8888888899999999999999999999998888876 79999999999999999888999999999999999


Q ss_pred             cCCcCcccCChhhhhcCCCCcEEEccCCcccccCCccCCCCCCCCEEEcccCccccccchHHhhCCCCCcEEEccccccc
Q 037315          177 SNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLALSNNSLK  256 (693)
Q Consensus       177 ~~n~~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~  256 (693)
                      ++|.+++.+|..+.. +++|++|++++|.+.+..|..++++++|++|++++|.+.+.+|..+. .+++|++|++++|.+.
T Consensus       220 ~~n~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~  297 (968)
T PLN00113        220 GYNNLSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLS  297 (968)
T ss_pred             cCCccCCcCChhHhc-CCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHh-hccCcCEEECcCCeec
Confidence            999999889988876 89999999999999999999999999999999999999888888776 5999999999999999


Q ss_pred             cccCccCCCCCCCCeEeccCccccccCCcCCcCCCCCCEEeccCCcccccCCccccCCCCCcEEEccCCccccCcccccc
Q 037315          257 GHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFC  336 (693)
Q Consensus       257 ~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~  336 (693)
                      +..|..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|+.|++++|.+.+..|..+.
T Consensus       298 ~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~  377 (968)
T PLN00113        298 GEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC  377 (968)
T ss_pred             cCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHh
Confidence            98899899999999999999999999999999999999999999999989999999999999999999999999999999


Q ss_pred             CCCCCCEEECcCCcCCCCCCCCCC-CCcccEEEccCcccccccCcccccCCCCCcEEeCcCcccCCCcchhhhCCCCCCE
Q 037315          337 HLYSLQILDISDNNISGSLPSCFH-PLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSH  415 (693)
Q Consensus       337 ~l~~L~~L~l~~n~~~~~~~~~~~-~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~  415 (693)
                      .+++|+.|++++|.+.+..|..+. +++|+.|++++|++.+.++. .+..+++|+.|++++|.+.+..+..+..+++|+.
T Consensus       378 ~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~-~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~  456 (968)
T PLN00113        378 SSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS-EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQM  456 (968)
T ss_pred             CcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECCh-hHhcCCCCCEEECcCCcccCccChhhccCCCCcE
Confidence            999999999999999988887654 78999999999999888876 7899999999999999999999988999999999


Q ss_pred             EEccCCcccccCCcccCCCCCCCEEEccCCcCcccCCCCcccCccccccCCCCCCchhhhHhhhhcccCCccccccccee
Q 037315          416 LILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFF  495 (693)
Q Consensus       416 L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  495 (693)
                      |++++|++.+..|..+ ..++|+.|++++|++.+..|..+..                                      
T Consensus       457 L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~--------------------------------------  497 (968)
T PLN00113        457 LSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGS--------------------------------------  497 (968)
T ss_pred             EECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhh--------------------------------------
Confidence            9999999998888765 4689999999999999888877655                                      


Q ss_pred             eeecccceeeeccccccCcceEECCCCcccccCchhhccCCCCCeeeCCCccCCccCcccccCCCCCCEEeCCCcccccc
Q 037315          496 EFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGK  575 (693)
Q Consensus       496 ~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~  575 (693)
                                     +++|+.|++++|.+.+.+|..+..+++|++|+|++|.+++.+|..|.++++|+.|||++|++++.
T Consensus       498 ---------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~  562 (968)
T PLN00113        498 ---------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGE  562 (968)
T ss_pred             ---------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccccc
Confidence                           55899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccccCCCCCEEecCCCcCcccCCCCccccCcCCcccccCccCCCCCC
Q 037315          576 IPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGLP  625 (693)
Q Consensus       576 ~~~~l~~l~~L~~L~l~~N~l~~~~p~~~~~~~~l~~~~~~~n~~~c~~~  625 (693)
                      +|..+..+++|+++++++|++.+.+|.. +++..+....+.|||.+|+.+
T Consensus       563 ~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        563 IPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999985 788888999999999999753



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-50
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-28
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-49
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-28
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-16
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 6e-06
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 194 bits (494), Expect = 9e-50, Method: Compositional matrix adjust. Identities = 187/665 (28%), Positives = 294/665 (44%), Gaps = 87/665 (13%) Query: 14 LANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEPLFNH--SRLK 71 L + + L+ L+VSSN L S L S+E L LS N + + + LK Sbjct: 119 LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELK 178 Query: 72 IFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQ 131 N I+ + S + ++S + S+ FL L+ + S + Sbjct: 179 HLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGI-------PFLGDCSALQHLDISGNK 231 Query: 132 MNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGD 191 ++G+F + + T+L+ L++ ++ GP +P + L+ L ++ N F G IP + Sbjct: 232 LSGDF-SRAISTCTELKLLNISSNQFVGP--IPPLPLKSLQYLSLAENKFTGEIPDFLSG 288 Query: 192 ILPRLISFNISMNALDGSIPSSFG-------------------------NMNLLQILDLS 226 L ++S N G++P FG M L++LDLS Sbjct: 289 ACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLS 348 Query: 227 NNQLTGEIPEHLAMGCVNLEFLALSNNSLKGHMFSRNFNLI-----NLRWLQLEGNHFVG 281 N+ +GE+PE L +L L LS+N+ G + NL L+ L L+ N F G Sbjct: 349 FNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP---NLCQNPKNTLQELYLQNNGFTG 405 Query: 282 EIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSL 341 +IP +LS CS L L+L+ N LSG IP LG+L+ L + + N LEG IP E ++ +L Sbjct: 406 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 465 Query: 342 QILDISDNNISGSLPSCFHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNG 401 + L + N+++G +PS NC++L + LS N L G Sbjct: 466 ETLILDFNDLTGEIPSGLS------------------------NCTNLNWISLSNNRLTG 501 Query: 402 SIPDWIDGLSQLSHLILGNNNLEGEVPVXXXXXXXXXXXXXXXXXXHGLIPPCF--DNTK 459 IP WI L L+ L L NN+ G +P +G IP + K Sbjct: 502 EIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGK 561 Query: 460 LHES--------YNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNI-AYIFQGKV 510 + + Y + ++ ++ QG +++ NI + ++ G Sbjct: 562 IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHT 621 Query: 511 LSLLSG------LDLSCNKLIGHIPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIES 564 LD+S N L G+IP ++G++ + LNL HN+++G IP +L+ + Sbjct: 622 SPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNI 681 Query: 565 LDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENSYEGNTFLCGL 624 LDLS NKL+G+IP + L L ++ NNLSG IPE QF TF + N LCG Sbjct: 682 LDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGY 740 Query: 625 PLPIC 629 PLP C Sbjct: 741 PLPRC 745
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-140
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-113
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-72
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-52
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-71
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-60
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-66
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-52
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-57
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-56
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-46
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-46
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-34
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-41
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-39
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-36
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-29
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-33
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-32
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-12
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  428 bits (1104), Expect = e-140
 Identities = 171/633 (27%), Positives = 258/633 (40%), Gaps = 95/633 (15%)

Query: 1   MADNELRGSLPWCLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPIS 60
           ++ N     +P+ L + ++L+ LD+S N+L+G  S + +   T ++ L++S+N F  PI 
Sbjct: 207 VSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFVGPI- 263

Query: 61  LEPLFNHSRLKIFYADNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQH 120
             P      L+      N    +I    +       L  L LS ++  G   P F     
Sbjct: 264 --PPLPLKSLQYLSLAENKFTGEIPDFLSGACDT--LTGLDLSGNHFYG-AVPPFFGSCS 318

Query: 121 DLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVNDSLAGPFRLPIHS-HRHLRLLDVSNN 179
            LE +  S    +GE P   L     L+ L L  +  +G     + +    L  LD+S+N
Sbjct: 319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 378

Query: 180 NFQGHIPVEIGDI-LPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHL 238
           NF G I   +       L    +  N   G IP +  N + L  L LS N L+G IP  L
Sbjct: 379 NFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL 438

Query: 239 AMGCVNLEFLALSNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYL 298
                 L  L L  N L+G +      +  L  L L+ N   GEIP  LS C++L  + L
Sbjct: 439 GS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISL 497

Query: 299 NNNSLSGKIPRWLGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSC 358
           +NN L+G+IP+W+G L  L  + +  N   G IP E     SL  LD++ N  +G++P+ 
Sbjct: 498 SNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAA 557

Query: 359 FHPLSITQVHLSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLIL 418
                                    F  S      ++ N + G    +I           
Sbjct: 558 M------------------------FKQS----GKIAANFIAGKRYVYIKNDGMKKECHG 589

Query: 419 GNN--NLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSSPDEQFKI 476
             N    +G    QL  L+     ++++    G   P FDN                   
Sbjct: 590 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDN------------------- 630

Query: 477 LFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGHIPPQVGNLT 536
                                                +  LD+S N L G+IP ++G++ 
Sbjct: 631 ----------------------------------NGSMMFLDMSYNMLSGYIPKEIGSMP 656

Query: 537 RIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNL 596
            +  LNL HN+++G IP    +L+ +  LDLS NKL+G+IP  +  L  L    ++ NNL
Sbjct: 657 YLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNL 716

Query: 597 SGEIPEWKAQFATFNENSYEGNTFLCGLPLPIC 629
           SG IPE   QF TF    +  N  LCG PLP C
Sbjct: 717 SGPIPEMG-QFETFPPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.38
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.3
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.32
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.99
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.19
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.0
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.98
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.1e-71  Score=629.25  Aligned_cols=621  Identities=30%  Similarity=0.444  Sum_probs=500.1

Q ss_pred             CCCCCCccCcch--hccCCCCCCEEECCCCCCCCcCCccccCCCCCCCEEECCCCcCcCcCCccc---ccCCCCCcEEEc
Q 037315            1 MADNELRGSLPW--CLANMTSLRILDVSSNQLTGSISSSPLFYLTSIEELSLSNNHFHIPISLEP---LFNHSRLKIFYA   75 (693)
Q Consensus         1 Ls~n~i~~~~~~--~~~~l~~L~~L~Ls~n~l~~~l~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~---~~~l~~L~~L~l   75 (693)
                      |++|.++|.+|.  .|+++++|++|||++|.+++.+|...+.++++|++|++++|++++..+ ..   +.++++|++|++
T Consensus       107 Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~~~~~~~~l~~L~~L~L  185 (768)
T 3rgz_A          107 LSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANV-VGWVLSDGCGELKHLAI  185 (768)
T ss_dssp             CCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETH-HHHHHTTCCTTCCEEEC
T ss_pred             CCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCC-hhhhhhccCCCCCEEEC
Confidence            455666665555  666666666666666666555554223556666666666666654433 22   556666666666


Q ss_pred             cCCccccccccccCCCCCCccccEEecCCCCCCCCcCchhhcCCCCCCEEEccCccccccCchhhhhcCCCCCEEEccCC
Q 037315           76 DNNPINAKITKSHTLTTPKFQLASLSLSSSYGDGVTFPKFLYYQHDLEDVHFSRIQMNGEFPNWLLENNTKLRQLSLVND  155 (693)
Q Consensus        76 ~~n~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~  155 (693)
                      ++|.+.+..+.     ....+|++|++ +.+.+.+.+|. ++.+++|++|++++|.+.+.+|..+ +++++|++|++++|
T Consensus       186 s~n~l~~~~~~-----~~l~~L~~L~L-s~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l~~L~~L~Ls~n  257 (768)
T 3rgz_A          186 SGNKISGDVDV-----SRCVNLEFLDV-SSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI-STCTELKLLNISSN  257 (768)
T ss_dssp             CSSEEESCCBC-----TTCTTCCEEEC-CSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT-TTCSSCCEEECCSS
T ss_pred             CCCcccccCCc-----ccCCcCCEEEC-cCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH-hcCCCCCEEECCCC
Confidence            66666543322     23448999999 77888877776 8899999999999999988877775 88999999999999


Q ss_pred             cccccCCCCCCCCCCCCEEEccCCcCcccCChhhhhcCCCCcEEEccCCcccccCCccCCCCCCCCEEEcccCccccccc
Q 037315          156 SLAGPFRLPIHSHRHLRLLDVSNNNFQGHIPVEIGDILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIP  235 (693)
Q Consensus       156 ~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~  235 (693)
                      .+.+..+..  .+++|++|++++|.+++.+|..++..+++|++|++++|.+++..|..|+++++|++|++++|.+.+.+|
T Consensus       258 ~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip  335 (768)
T 3rgz_A          258 QFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELP  335 (768)
T ss_dssp             CCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECC
T ss_pred             cccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCC
Confidence            998766554  889999999999999989999888767999999999999999999999999999999999999998999


Q ss_pred             hHHhhCCCCCcEEEccccccccccCccCCCCC-CCCeEeccCccccccCCcCCcC--CCCCCEEeccCCcccccCCcccc
Q 037315          236 EHLAMGCVNLEFLALSNNSLKGHMFSRNFNLI-NLRWLQLEGNHFVGEIPQSLSK--CSSLEGLYLNNNSLSGKIPRWLG  312 (693)
Q Consensus       236 ~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~-~L~~L~L~~n~l~~~~~~~l~~--l~~L~~L~L~~n~i~~~~~~~l~  312 (693)
                      ...+..+++|++|++++|.+.+..|..+..++ +|++|++++|.+.+..+..+..  +++|++|++++|.+++..|..+.
T Consensus       336 ~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~  415 (768)
T 3rgz_A          336 MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS  415 (768)
T ss_dssp             HHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG
T ss_pred             HHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh
Confidence            88677899999999999999988888888887 9999999999999888887776  88999999999999999999999


Q ss_pred             CCCCCcEEEccCCccccCccccccCCCCCCEEECcCCcCCCCCCCCCC-CCcccEEEccCcccccccCcccccCCCCCcE
Q 037315          313 NLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFH-PLSITQVHLSKNMLHGQLKGGTFFNCSSLVT  391 (693)
Q Consensus       313 ~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~-~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~  391 (693)
                      .+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+. .++|+.|++++|++.+.+|. .+..+++|++
T Consensus       416 ~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~-~l~~l~~L~~  494 (768)
T 3rgz_A          416 NCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPS-GLSNCTNLNW  494 (768)
T ss_dssp             GCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCG-GGGGCTTCCE
T ss_pred             cCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCH-HHhcCCCCCE
Confidence            999999999999999999999999999999999999999988887665 78999999999999888887 8899999999


Q ss_pred             EeCcCcccCCCcchhhhCCCCCCEEEccCCcccccCCcccCCCCCCCEEEccCCcCcccCCCCcccCccccccCCCCC--
Q 037315          392 LDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQLQLLDLSNNNLHGLIPPCFDNTKLHESYNNSSS--  469 (693)
Q Consensus       392 L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~l~~~~~~~~~--  469 (693)
                      |++++|.+++.+|.++..+++|++|++++|++++.+|..+..+++|++|++++|++++.+|..+....-.........  
T Consensus       495 L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~  574 (768)
T 3rgz_A          495 ISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKR  574 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCE
T ss_pred             EEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccc
Confidence            999999999999999999999999999999999999999999999999999999999998887655321111000000  


Q ss_pred             --------Cchhhh---HhhhhcccCCccccccc--ceeeeecccceee--eccccccCcceEECCCCcccccCchhhcc
Q 037315          470 --------PDEQFK---ILFSIKGHQGHVEKKIQ--EFFEFTTKNIAYI--FQGKVLSLLSGLDLSCNKLIGHIPPQVGN  534 (693)
Q Consensus       470 --------~~~~~~---~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~--~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~  534 (693)
                              ......   ....+.+..........  .............  .....+++|+.||+++|++++.+|..++.
T Consensus       575 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~  654 (768)
T 3rgz_A          575 YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGS  654 (768)
T ss_dssp             EEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGG
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhc
Confidence                    000000   00000000000000000  0000000000000  01123678999999999999999999999


Q ss_pred             CCCCCeeeCCCccCCccCcccccCCCCCCEEeCCCccccccCCcccccCCCCCEEecCCCcCcccCCCCccccCcCCccc
Q 037315          535 LTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQFATFNENS  614 (693)
Q Consensus       535 l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~l~~N~l~~~~p~~~~~~~~l~~~~  614 (693)
                      +++|+.|+|++|++++.+|..++++++|++|||++|++++.+|..+..+++|++|++++|+++|.+|+. .++.++...+
T Consensus       655 l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~~~~~~~  733 (768)
T 3rgz_A          655 MPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPPAK  733 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGGGSCGGG
T ss_pred             cccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhccCCHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999999986 7899999999


Q ss_pred             ccCccCCCCCCCCCCCCCCC
Q 037315          615 YEGNTFLCGLPLPICRSPTT  634 (693)
Q Consensus       615 ~~~n~~~c~~~~~~c~~~~~  634 (693)
                      +.|||.+|+.|+..|.....
T Consensus       734 ~~gN~~Lcg~~l~~C~~~~~  753 (768)
T 3rgz_A          734 FLNNPGLCGYPLPRCDPSNA  753 (768)
T ss_dssp             GCSCTEEESTTSCCCCSCC-
T ss_pred             hcCCchhcCCCCcCCCCCcc
Confidence            99999999999888875443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 693
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-06
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 86.8 bits (213), Expect = 2e-19
 Identities = 50/259 (19%), Positives = 82/259 (31%), Gaps = 4/259 (1%)

Query: 191 DILPRLISFNISMNALDGSIPSSFGNMNLLQILDLSNNQLTGEIPEHLAMGCVNLEFLAL 250
            I        +  N +     +SF     L IL L +N L            +  +    
Sbjct: 29  GIPAASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLS 88

Query: 251 SNNSLKGHMFSRNFNLINLRWLQLEGNHFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRW 310
            N  L+    +    L  L  L L+        P      ++L+ LYL +N+L       
Sbjct: 89  DNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDT 148

Query: 311 LGNLTWLIHIIMPKNHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVHLS 370
             +L  L H+ +  N +       F  L+SL  L +  N ++   P  F  L        
Sbjct: 149 FRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYL 208

Query: 371 KNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQ 430
                  L         +L  L L+ N             + L      ++ +   +P +
Sbjct: 209 FANNLSALPTEALAPLRALQYLRLNDNPWVCDC-RARPLWAWLQKFRGSSSEVPCSLPQR 267

Query: 431 LCGLNQLQLLDLSNNNLHG 449
           L G     L  L+ N+L G
Sbjct: 268 LAG---RDLKRLAANDLQG 283


>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.45
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.06
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.75
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=4.6e-30  Score=257.54  Aligned_cols=259  Identities=35%  Similarity=0.574  Sum_probs=218.2

Q ss_pred             CCCEEeccCCcccc--cCCccccCCCCCcEEEccC-CccccCccccccCCCCCCEEECcCCcCCCCCCCCCCCCcccEEE
Q 037315          292 SLEGLYLNNNSLSG--KIPRWLGNLTWLIHIIMPK-NHLEGPIPVEFCHLYSLQILDISDNNISGSLPSCFHPLSITQVH  368 (693)
Q Consensus       292 ~L~~L~L~~n~i~~--~~~~~l~~l~~L~~L~l~~-n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~L~~L~  368 (693)
                      +++.|+++++.+.+  .+|..++++++|++|++++ |.+.+.+|..+.++++|++|++++|++.+..             
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~-------------  117 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAI-------------  117 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEEC-------------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccc-------------
Confidence            46667777776665  3566777777777777765 6677777777778888888888777776322             


Q ss_pred             ccCcccccccCcccccCCCCCcEEeCcCcccCCCcchhhhCCCCCCEEEccCCcccccCCcccCCCCCC-CEEEccCCcC
Q 037315          369 LSKNMLHGQLKGGTFFNCSSLVTLDLSYNLLNGSIPDWIDGLSQLSHLILGNNNLEGEVPVQLCGLNQL-QLLDLSNNNL  447 (693)
Q Consensus       369 l~~n~~~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~l~~n~~  447 (693)
                                +. .+..+++|+.+++++|.+...+|..+.+++.++++++++|.+.+.+|..+..+..+ +.+++++|++
T Consensus       118 ----------~~-~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l  186 (313)
T d1ogqa_         118 ----------PD-FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL  186 (313)
T ss_dssp             ----------CG-GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEE
T ss_pred             ----------cc-cccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccc
Confidence                      22 56778889999999998888889999999999999999999998899888888776 8899999999


Q ss_pred             cccCCCCcccCccccccCCCCCCchhhhHhhhhcccCCcccccccceeeeecccceeeeccccccCcceEECCCCccccc
Q 037315          448 HGLIPPCFDNTKLHESYNNSSSPDEQFKILFSIKGHQGHVEKKIQEFFEFTTKNIAYIFQGKVLSLLSGLDLSCNKLIGH  527 (693)
Q Consensus       448 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~  527 (693)
                      ++..|..+...                                                      ....++++++...+.
T Consensus       187 ~~~~~~~~~~l------------------------------------------------------~~~~l~l~~~~~~~~  212 (313)
T d1ogqa_         187 TGKIPPTFANL------------------------------------------------------NLAFVDLSRNMLEGD  212 (313)
T ss_dssp             EEECCGGGGGC------------------------------------------------------CCSEEECCSSEEEEC
T ss_pred             ccccccccccc------------------------------------------------------ccccccccccccccc
Confidence            98877766542                                                      245799999999999


Q ss_pred             CchhhccCCCCCeeeCCCccCCccCcccccCCCCCCEEeCCCccccccCCcccccCCCCCEEecCCCcCcccCCCCcccc
Q 037315          528 IPPQVGNLTRIQTLNLSHNNLTGLIPSTFSNLKQIESLDLSYNKLNGKIPHQLVELKELAVFSVAYNNLSGEIPEWKAQF  607 (693)
Q Consensus       528 ~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~l~~N~l~~~~p~~~~~~  607 (693)
                      +|..+..+++++.+++++|.+.+.+| .+..+++|+.|+|++|++++.+|..+..+++|++|++++|+++|.+|++ ..+
T Consensus       213 ~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~~L  290 (313)
T d1ogqa_         213 ASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNL  290 (313)
T ss_dssp             CGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTG
T ss_pred             cccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-ccC
Confidence            99999999999999999999987754 6888999999999999999999999999999999999999999999985 788


Q ss_pred             CcCCcccccCccCCCCCCCCCCC
Q 037315          608 ATFNENSYEGNTFLCGLPLPICR  630 (693)
Q Consensus       608 ~~l~~~~~~~n~~~c~~~~~~c~  630 (693)
                      +++..+++.+|+.+|+.|+..|.
T Consensus       291 ~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         291 QRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             GGSCGGGTCSSSEEESTTSSCCC
T ss_pred             CCCCHHHhCCCccccCCCCCCCC
Confidence            99999999999999999988874



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure