Citrus Sinensis ID: 037339

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------

MSTYRATARILRSLMWQAAGANYSSSSLTSGRHLMSRYPAGIVRYWSSASSSSSSSSSSSSAPPVDLPKDKEEINQQNIVSYWGIIPTKVTKEDGSAWRWNCFRHHKPENYRDKFAYWTVQALKFPTHLFFQRRHMCHAMLLQTVAAVPGMVGGMLLHCKSLRKFEHSGGWIKALLEEAENERMHLMTFIELARPQWYERALVFAVQGVFFNAYFLAYLASPKLAHRIVGYLEEEAVNSYTEFLKDLENGSFENAPAPAIAIDYWRMPPDSTLRDVVVDIQCQGHELKDAPAPVGYH

cccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccHHHHHHHcccccccHHHHHHHHHHccccccccccccccc

********RILRSLMWQAAGANY*********HLMSRYPAGIVRYW******************************QNIVSYWGIIPTKVTKEDGSAWRWNCFRHHKPENYRDKFAYWTVQALKFPTHLFFQRRHMCHAMLLQTVAAVPGMVGGMLLHCKSLRKFEHSGGWIKALLEEAENERMHLMTFIELARPQWYERALVFAVQGVFFNAYFLAYLASPKLAHRIVGYLEEEAVNSYTEFLKDLENGSFENAPAPAIAIDYWRMPPDSTLRDVVVDIQCQGHELKDA*A*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquinol oxidase 3, mitochondrial	Catalyzes cyanide-resistant oxygen consumption. May increase respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.	probable	Q8LEE7
Ubiquinol oxidase 1, mitochondrial	Catalyzes cyanide-resistant oxygen consumption. May increase respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.	probable	Q07185

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 254-263
View the alignment between query and template
View the model in PyMOL