Citrus Sinensis ID: 037375

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MTGEALQISPANDPHGSPAKEQQAAGVGILLQIMMLVLSFILGHVLRRHKFYYLPEASASLLIGLIVSALTNISNTETNIRYSFSFNELICSVATCLLMILFSWQKPFFSNFGAIVTFAIFGTFLASMVTGILVYLGGVMFVMYRLPFVECLMFGALISATDPITVLSIFQGTCALLFCLLTG
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHccccccEEEEccc
************************AGVGILLQIMMLVLSFILGHVLRRHKFYYLPEASASLLIGLIVSALTNISNTETNIRYSFSFNELICSVATCLLMILFSWQKPFFSNFGAIVTFAIFGTFLASMVTGILVYLGGVMFVMYRLPFVECLMFGALISATDPITVLSIFQGTCALLFCLLTG
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGEALQISPANDPHGSPAKEQQAAGVGILLQIMMLVLSFILGHVLRRHKFYYLPEASASLLIGLIVSALTNISNTETNIRYSFSFNELICSVATCLLMILFSWQKPFFSNFGAIVTFAIFGTFLASMVTGILVYLGGVMFVMYRLPFVECLMFGALISATDPITVLSIFQGTCALLFCLLTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 6 Involved in trafficking to the vacuole. Required for cell proliferation and cell expansion, but not for cell differentiation. May act in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes. May also exchange Li(+) and Cs(+) with a lower affinity.probableQ8RWU6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0E, chain A
Confidence level:confident
Coverage over the Query: 147-174
View the alignment between query and template
View the model in PyMOL