Citrus Sinensis ID: 037406


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTEARANNEAKAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
cHHHHHHHHHHccccEEEEEEcccccccccHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHcc
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTEARANNEAKAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTExxxxxxxxxxxxxxxxxxxxxxxxLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucomannan 4-beta-mannosyltransferase 2 Possesses glucomannan synthase and mannan synthase activities in vitro. Mannan synthase consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product is the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharides of plant cell wall.probableQ9FNI7
Glucomannan 4-beta-mannosyltransferase 1 Possesses glucomannan synthase and mannan synthase activities in vitro. Mannan synthase consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product is the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharides of plant cell wall.probableQ7PC76

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z86, chain A
Confidence level:very confident
Coverage over the Query: 3-87
View the alignment between query and template
View the model in PyMOL