Citrus Sinensis ID: 037406

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTEARANNEAKAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
cHHHHHHHHHHccccEEEEEEcccccccccHHHHHHcccccccccEEEEEcccccccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHcc
cHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHccHHHHcccEEEEEccccccccHHHHHHcHHHcccccEEEEEEEEEEEcccHHHHHEEcccEEEEEEEEcccccccHcHHHHHHHHHccccHHHHHHHHHHHHHHHcccEEEEEcccEEEEEEEEc
MVEQECQRWAAKGINIryesrenrtgykagalKEGLKRSYVKHCEyvaifdvdfrlepdylrraipylvqnsdIALVQARWRFAKEAKELTEARANNEAKAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
mveqecqrwaakginiryesrenrtgykagalkeglkrsYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTearanneakAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTEARANNEAKAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
*******RWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAK*******************************LVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVV**
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTEARANNEAKAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKEL******************DAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTEARANNEAKAELESRLRDAQEHETMLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTExxxxxxxxxxxxxxxxxxxxxxxxLVQALEELRQTLSRIKQQVFALFIEIVGLNLANLQNDVLRLCVVAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q9FNI7 534 Glucomannan 4-beta-mannos yes no 0.512 0.155 0.807 6e-38
Q7PC76 521 Glucomannan 4-beta-mannos yes no 0.512 0.159 0.734 4e-34
Q9T0L2 537 Probable mannan synthase no no 0.512 0.154 0.674 6e-32
Q9LZR3 533 Glucomannan 4-beta-mannos no no 0.512 0.155 0.674 7e-32
Q6YWK8 570 Probable mannan synthase no no 0.512 0.145 0.662 3e-31
Q9LF09 443 Probable mannan synthase no no 0.648 0.237 0.559 4e-31
Q67VS7 527 Probable mannan synthase no no 0.512 0.157 0.650 6e-31
Q9LR87 552 Probable mannan synthase no no 0.648 0.190 0.541 9e-30
Q84W54 553 Probable mannan synthase no no 0.641 0.188 0.546 8e-29
Q9ZQN8 556 Probable mannan synthase no no 0.543 0.158 0.545 2e-28
>sp|Q9FNI7|CSLA2_ARATH Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana GN=CSLA2 PE=2 SV=1 Back     alignment and function desciption
 Score =  156 bits (394), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 67/83 (80%), Positives = 75/83 (90%)

Query: 1   MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDY 60
           MVE ECQRWA+KGINIRY+ RENR GYKAGALKEGLKRSYVKHCEYV IFD DF+ EPD+
Sbjct: 145 MVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEYVVIFDADFQPEPDF 204

Query: 61  LRRAIPYLVQNSDIALVQARWRF 83
           LRR+IP+L+ N +IALVQARWRF
Sbjct: 205 LRRSIPFLMHNPNIALVQARWRF 227
Possesses glucomannan synthase and mannan synthase activities in vitro. Mannan synthase consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product is the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharides of plant cell wall.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 3EC: 2
>sp|Q7PC76|CSLA1_ORYSJ Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica GN=CSLA1 PE=3 SV=1 Back     alignment and function description
>sp|Q9T0L2|CSLAF_ARATH Probable mannan synthase 15 OS=Arabidopsis thaliana GN=CSLA15 PE=3 SV=2 Back     alignment and function description
>sp|Q9LZR3|CSLA9_ARATH Glucomannan 4-beta-mannosyltransferase 9 OS=Arabidopsis thaliana GN=CSLA9 PE=2 SV=1 Back     alignment and function description
>sp|Q6YWK8|CSLAB_ORYSJ Probable mannan synthase 11 OS=Oryza sativa subsp. japonica GN=CSLA11 PE=2 SV=1 Back     alignment and function description
>sp|Q9LF09|CSLAB_ARATH Probable mannan synthase 11 OS=Arabidopsis thaliana GN=CSLA11 PE=2 SV=2 Back     alignment and function description
>sp|Q67VS7|CSLA9_ORYSJ Probable mannan synthase 9 OS=Oryza sativa subsp. japonica GN=CSLA9 PE=2 SV=1 Back     alignment and function description
>sp|Q9LR87|CSLAA_ARATH Probable mannan synthase 10 OS=Arabidopsis thaliana GN=CSLA10 PE=2 SV=2 Back     alignment and function description
>sp|Q84W54|CSLA1_ARATH Probable mannan synthase 1 OS=Arabidopsis thaliana GN=CSLA1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQN8|CSLA7_ARATH Probable mannan synthase 7 OS=Arabidopsis thaliana GN=CSLA7 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
224132072 540 predicted protein [Populus trichocarpa] 0.512 0.153 0.843 2e-37
449496242233 PREDICTED: glucomannan 4-beta-mannosyltr 0.524 0.364 0.847 3e-37
225436353 533 PREDICTED: glucomannan 4-beta-mannosyltr 0.512 0.155 0.843 3e-37
449456082 539 PREDICTED: glucomannan 4-beta-mannosyltr 0.512 0.153 0.855 5e-37
224103023 537 predicted protein [Populus trichocarpa] 0.512 0.154 0.831 7e-37
429326478 540 cellulose synthase-like protein [Populus 0.512 0.153 0.831 9e-37
297734855 429 unnamed protein product [Vitis vinifera] 0.512 0.193 0.843 1e-36
356565701 533 PREDICTED: glucomannan 4-beta-mannosyltr 0.512 0.155 0.843 2e-36
297812399 534 hypothetical protein ARALYDRAFT_489123 [ 0.512 0.155 0.807 2e-36
15242959 534 glucomannan 4-beta-mannosyltransferase 2 0.512 0.155 0.807 3e-36
>gi|224132072|ref|XP_002328178.1| predicted protein [Populus trichocarpa] gi|222837693|gb|EEE76058.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/83 (84%), Positives = 76/83 (91%)

Query: 1   MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDY 60
           MVE ECQRWA+KGINIRY+ RENRTGYKAGALKEGLKRSYVKHCEYV IFD DF+ EPD+
Sbjct: 147 MVELECQRWASKGINIRYQIRENRTGYKAGALKEGLKRSYVKHCEYVCIFDADFQPEPDF 206

Query: 61  LRRAIPYLVQNSDIALVQARWRF 83
           LRRAIP+LV N D+ALVQARWRF
Sbjct: 207 LRRAIPFLVHNPDVALVQARWRF 229

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449496242|ref|XP_004160082.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225436353|ref|XP_002269677.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456082|ref|XP_004145779.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224103023|ref|XP_002312893.1| predicted protein [Populus trichocarpa] gi|222849301|gb|EEE86848.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|429326478|gb|AFZ78579.1| cellulose synthase-like protein [Populus tomentosa] Back     alignment and taxonomy information
>gi|297734855|emb|CBI17089.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356565701|ref|XP_003551076.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|297812399|ref|XP_002874083.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. lyrata] gi|297319920|gb|EFH50342.1| hypothetical protein ARALYDRAFT_489123 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242959|ref|NP_197666.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana] gi|75171864|sp|Q9FNI7.1|CSLA2_ARATH RecName: Full=Glucomannan 4-beta-mannosyltransferase 2; AltName: Full=Cellulose synthase-like protein A2; Short=AtCslA2; AltName: Full=Glucomannan synthase; AltName: Full=Mannan synthase 2 gi|10178248|dbj|BAB11680.1| glucosyltransferase-like protein [Arabidopsis thaliana] gi|16648764|gb|AAL25573.1| AT5g22740/MDJ22_16 [Arabidopsis thaliana] gi|16648965|gb|AAL24334.1| glucosyltransferase-like protein [Arabidopsis thaliana] gi|20259890|gb|AAM13292.1| glucosyltransferase-like protein [Arabidopsis thaliana] gi|332005686|gb|AED93069.1| glucomannan 4-beta-mannosyltransferase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2162494 534 CSLA02 "cellulose synthase-lik 0.512 0.155 0.807 7.8e-34
TAIR|locus:2142100 537 ATCSLA15 [Arabidopsis thaliana 0.512 0.154 0.674 7.7e-29
TAIR|locus:2144638 533 ATCSLA09 [Arabidopsis thaliana 0.512 0.155 0.674 9.5e-29
TAIR|locus:2181382 443 CSLA11 "cellulose synthase lik 0.648 0.237 0.550 1.2e-28
TAIR|locus:2199917 552 CSLA10 "cellulose synthase-lik 0.648 0.190 0.541 2.5e-27
TAIR|locus:2130844 553 CSLA01 "cellulose synthase-lik 0.641 0.188 0.546 5.2e-26
TAIR|locus:2058729 556 CSLA07 "cellulose synthase lik 0.512 0.149 0.578 8.9e-26
TAIR|locus:2028862 556 CSLA03 "cellulose synthase-lik 0.648 0.188 0.532 2.4e-25
TAIR|locus:2089730 673 CSLC04 "Cellulose-synthase-lik 0.555 0.133 0.455 6.8e-20
TAIR|locus:2124804 692 CSLC5 "Cellulose-synthase-like 0.555 0.130 0.455 1.5e-19
TAIR|locus:2162494 CSLA02 "cellulose synthase-like A02" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.8e-34, P = 7.8e-34
 Identities = 67/83 (80%), Positives = 75/83 (90%)

Query:     1 MVEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDY 60
             MVE ECQRWA+KGINIRY+ RENR GYKAGALKEGLKRSYVKHCEYV IFD DF+ EPD+
Sbjct:   145 MVEVECQRWASKGINIRYQIRENRVGYKAGALKEGLKRSYVKHCEYVVIFDADFQPEPDF 204

Query:    61 LRRAIPYLVQNSDIALVQARWRF 83
             LRR+IP+L+ N +IALVQARWRF
Sbjct:   205 LRRSIPFLMHNPNIALVQARWRF 227
GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0051753 "mannan synthase activity" evidence=IDA
TAIR|locus:2142100 ATCSLA15 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144638 ATCSLA09 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181382 CSLA11 "cellulose synthase like A11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199917 CSLA10 "cellulose synthase-like A10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130844 CSLA01 "cellulose synthase-like A01" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058729 CSLA07 "cellulose synthase like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028862 CSLA03 "cellulose synthase-like A3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089730 CSLC04 "Cellulose-synthase-like C4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124804 CSLC5 "Cellulose-synthase-like C5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FNI7CSLA2_ARATH2, ., 4, ., 1, ., 3, 20.80720.51230.1554yesno
Q7PC76CSLA1_ORYSJ2, ., 4, ., 1, ., 3, 20.73490.51230.1593yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00660037
hypothetical protein (540 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
cd06437232 cd06437, CESA_CaSu_A2, Cellulose synthase catalyti 3e-31
cd06421234 cd06421, CESA_CelA_like, CESA_CelA_like are involv 1e-16
cd06423180 cd06423, CESA_like, CESA_like is the cellulose syn 4e-09
cd06435236 cd06435, CESA_NdvC_like, NdvC_like proteins in thi 3e-08
COG1215 439 COG1215, COG1215, Glycosyltransferases, probably i 5e-08
pfam13641229 pfam13641, Glyco_tranf_2_3, Glycosyltransferase li 2e-07
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase f 7e-07
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase 3e-06
TIGR03030 713 TIGR03030, CelA, cellulose synthase catalytic subu 9e-06
cd02526237 cd02526, GT2_RfbF_like, RfbF is a putative dTDP-rh 0.003
>gnl|CDD|133059 cd06437, CESA_CaSu_A2, Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information 
 Score =  112 bits (281), Expect = 3e-31
 Identities = 39/95 (41%), Positives = 53/95 (55%), Gaps = 6/95 (6%)

Query: 2   VEQECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYL 61
            E   +  A +G+NI++  R +RTGYKAGAL EG+K +     EYVAIFD DF   PD+L
Sbjct: 50  REIVEEYAA-QGVNIKHVRRADRTGYKAGALAEGMKVA---KGEYVAIFDADFVPPPDFL 105

Query: 62  RRAIPYLVQNSDIALVQARWRFAKEAKE-LTEARA 95
           ++  PY   +  +  VQ RW         LT  +A
Sbjct: 106 QKTPPY-FADPKLGFVQTRWGHINANYSLLTRVQA 139

Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal. Length = 232
>gnl|CDD|133043 cd06421, CESA_CelA_like, CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>gnl|CDD|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|133057 cd06435, CESA_NdvC_like, NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|222281 pfam13641, Glyco_tranf_2_3, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|234095 TIGR03030, CelA, cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>gnl|CDD|133017 cd02526, GT2_RfbF_like, RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon 99.83
PRK14583 444 hmsR N-glycosyltransferase; Provisional 99.79
PRK11498 852 bcsA cellulose synthase catalytic subunit; Provisi 99.78
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit 99.78
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-for 99.77
PRK11204 420 N-glycosyltransferase; Provisional 99.76
TIGR03111 439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 99.71
COG1215 439 Glycosyltransferases, probably involved in cell wa 99.71
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 99.71
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transf 99.7
PRK05454 691 glucosyltransferase MdoH; Provisional 99.69
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 99.68
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the 99.66
TIGR03472 373 HpnI hopanoid biosynthesis associated glycosyl tra 99.65
cd06438183 EpsO_like EpsO protein participates in the methano 99.64
cd06423180 CESA_like CESA_like is the cellulose synthase supe 99.55
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 99.54
PF13641228 Glyco_tranf_2_3: Glycosyltransferase like family 2 99.52
PF13506175 Glyco_transf_21: Glycosyl transferase family 21 99.52
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 99.52
PRK14716 504 bacteriophage N4 adsorption protein B; Provisional 99.48
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Famil 99.48
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthas 99.47
PLN02893 734 Cellulose synthase-like protein 99.46
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 99.46
cd02520196 Glucosylceramide_synthase Glucosylceramide synthas 99.43
PRK11234 727 nfrB bacteriophage N4 adsorption protein B; Provis 99.37
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 99.35
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 99.32
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 99.3
PRK15489 703 nfrB bacteriophage N4 adsorption protein B; Provis 99.29
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 99.26
TIGR03469 384 HonB hopene-associated glycosyltransferase HpnB. T 99.25
cd06442224 DPM1_like DPM1_like represents putative enzymes si 99.24
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 99.21
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.21
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 99.2
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 99.19
PF13632193 Glyco_trans_2_3: Glycosyl transferase family group 99.15
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 99.15
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 99.14
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 99.11
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 99.1
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 99.03
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 99.03
cd04188211 DPG_synthase DPG_synthase is involved in protein N 99.01
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 98.99
PRK10073 328 putative glycosyl transferase; Provisional 98.94
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 98.91
PLN02189 1040 cellulose synthase 98.9
PLN02195 977 cellulose synthase A 98.89
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 98.88
PRK10018279 putative glycosyl transferase; Provisional 98.88
PTZ00260333 dolichyl-phosphate beta-glucosyltransferase; Provi 98.82
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 98.82
COG2943 736 MdoH Membrane glycosyltransferase [Cell envelope b 98.79
PRK10714 325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 98.75
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 98.68
PLN02248 1135 cellulose synthase-like protein 98.65
COG1216 305 Predicted glycosyltransferases [General function p 98.58
PLN02436 1094 cellulose synthase A 98.55
PRK13915306 putative glucosyl-3-phosphoglycerate synthase; Pro 98.54
PRK10063248 putative glycosyl transferase; Provisional 98.5
PF03552 720 Cellulose_synt: Cellulose synthase; InterPro: IPR0 98.48
PLN02400 1085 cellulose synthase 98.41
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 98.33
PLN02190 756 cellulose synthase-like protein 98.28
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 98.24
PF03142 527 Chitin_synth_2: Chitin synthase; InterPro: IPR0048 98.0
KOG2978238 consensus Dolichol-phosphate mannosyltransferase [ 97.91
PF13712217 Glyco_tranf_2_5: Glycosyltransferase like family; 97.85
KOG2547 431 consensus Ceramide glucosyltransferase [Lipid tran 97.75
KOG2571 862 consensus Chitin synthase/hyaluronan synthase (gly 97.69
COG0463291 WcaA Glycosyltransferases involved in cell wall bi 97.49
cd02514 334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es 97.46
KOG3736 578 consensus Polypeptide N-acetylgalactosaminyltransf 95.43
KOG2977323 consensus Glycosyltransferase [General function pr 95.12
KOG3737 603 consensus Predicted polypeptide N-acetylgalactosam 93.78
KOG3738 559 consensus Predicted polypeptide N-acetylgalactosam 93.71
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 93.23
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 92.1
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 91.99
PF11316234 Rhamno_transf: Putative rhamnosyl transferase ; In 91.48
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 90.74
cd02503181 MobA MobA catalyzes the formation of molybdopterin 89.1
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 88.19
cd04181217 NTP_transferase NTP_transferases catalyze the tran 87.86
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 86.97
PF03452269 Anp1: Anp1; InterPro: IPR005109 The members of thi 86.77
PF13896317 Glyco_transf_49: Glycosyl-transferase for dystrogl 86.6
PRK14355 459 glmU bifunctional N-acetylglucosamine-1-phosphate 86.28
PRK14353 446 glmU bifunctional N-acetylglucosamine-1-phosphate 86.04
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 85.59
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 85.17
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 84.7
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 84.01
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 83.8
COG4092 346 Predicted glycosyltransferase involved in capsule 83.45
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 82.93
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 82.46
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 81.61
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information 
Probab=99.83  E-value=5.7e-20  Score=150.79  Aligned_cols=83  Identities=19%  Similarity=0.277  Sum_probs=74.4

Q ss_pred             CCCEEEEEeCCCCCChHHHHHHHHHhccCCCccEEEEEcCCCCCChHHHHHHHHHHhcCCCeEEEecceeeecCCccHHH
Q 037406           13 GINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFAKEAKELTE   92 (162)
Q Consensus        13 ~~~v~~i~~~~~~G~KagAlN~gl~~a~~~~ge~i~i~DAD~~~~pd~L~~lv~~f~~dp~vg~V~~~~~~~N~~~~l~~   92 (162)
                      .++++|++++++.|.|+|++|.++... ..++|||+++|||++++||+|++++++|..||++|+||+++.+.|.++.+++
T Consensus        66 ~~~v~~~~r~~~~g~Kag~l~~~~~~~-~~~~~~i~~~DaD~~~~p~~l~~~v~~~~~~~~vg~vq~~~~~~n~~~~~~~  144 (254)
T cd04191          66 QGRIYYRRRRENTGRKAGNIADFCRRW-GSRYDYMVVLDADSLMSGDTIVRLVRRMEANPRAGIIQTAPKLIGAETLFAR  144 (254)
T ss_pred             CCcEEEEEcCCCCCccHHHHHHHHHHh-CCCCCEEEEEeCCCCCCHHHHHHHHHHHHhCCCEEEEeCCceeECCCCHHHH
Confidence            678999999999999999999999871 2389999999999999999999999999779999999999999998866777


Q ss_pred             HHHH
Q 037406           93 ARAN   96 (162)
Q Consensus        93 ~~~~   96 (162)
                      .+..
T Consensus       145 ~~~~  148 (254)
T cd04191         145 LQQF  148 (254)
T ss_pred             HHHH
Confidence            7653

Periplasmic Glucan Biosynthesis protein ModH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
>PRK14583 hmsR N-glycosyltransferase; Provisional Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A Back     alignment and domain information
>PF13506 Glyco_transf_21: Glycosyl transferase family 21 Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>PRK14716 bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>PLN02893 Cellulose synthase-like protein Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>PLN02248 cellulose synthase-like protein Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>PRK10063 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF03552 Cellulose_synt: Cellulose synthase; InterPro: IPR005150 Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>PLN02190 cellulose synthase-like protein Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 Back     alignment and domain information
>KOG2978 consensus Dolichol-phosphate mannosyltransferase [General function prediction only] Back     alignment and domain information
>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B Back     alignment and domain information
>KOG2547 consensus Ceramide glucosyltransferase [Lipid transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2571 consensus Chitin synthase/hyaluronan synthase (glycosyltransferases) [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2977 consensus Glycosyltransferase [General function prediction only] Back     alignment and domain information
>KOG3737 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3738 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function Back     alignment and domain information
>PF13896 Glyco_transf_49: Glycosyl-transferase for dystroglycan Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
4hg6_A 802 Structure Of A Cellulose Synthase - Cellulose Trans 9e-04
>pdb|4HG6|A Chain A, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate Length = 802 Back     alignment and structure 
Iteration: 1

 Score = 39.7 bits (91), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 3/65 (4%)
Query: 14  INIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSD 73
           + + Y +RE     KAG +   L+R      E V +FD D     D+L R + Y V++ D
Sbjct: 212 LGVVYSTRERNEHAKAGNMSAALERL---KGELVVVFDADHVPSRDFLARTVGYFVEDPD 268
Query: 74  IALVQ 78
           + LVQ
Sbjct: 269 LFLVQ 273

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 4e-06
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 5e-05
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
 Score = 44.5 bits (105), Expect = 4e-06
 Identities = 17/104 (16%), Positives = 39/104 (37%), Gaps = 4/104 (3%)

Query: 6   CQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAI 65
            + + +   NI+Y  +++           GL+ +      YVAI D D    P +++  +
Sbjct: 141 VREFESLL-NIKYVRQKDYGYQLCAVRNLGLRAA---KYNYVAILDCDMAPNPLWVQSYM 196

Query: 66  PYLVQNSDIALVQARWRFAKEAKELTEARANNEAKAELESRLRD 109
             L  + ++AL+  R           +  +      E+   + +
Sbjct: 197 ELLAVDDNVALIGPRKYIDTSKHTYLDFLSQKSLINEIPEIITN 240
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
4hg6_A 802 Cellulose synthase subunit A; membrane translocati 99.5
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 99.28
3bcv_A240 Putative glycosyltransferase protein; protein stru 99.22
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.21
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.06
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.06
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.04
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 98.89
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 98.86
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 98.77
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 98.74
4fix_A 657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 98.67
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 98.53
2bo4_A 397 Mannosylglycerate synthase; catalysis, glycosyltra 98.15
1fo8_A 343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl 97.15
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 97.08
2wvl_A 391 Mannosyl-3-phosphoglycerate synthase; GT-A fold, t 96.17
2zu9_A 394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 94.61
2c0n_A203 A197; thermophil protein, thermophilic virus, STIV 93.73
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 90.42
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 90.02
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 89.45
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 84.45
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 84.27
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 83.51
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 83.48
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 83.1
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 82.87
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 82.26
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 82.09
3pnn_A303 Conserved domain protein; structural genomics, PSI 81.39
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 81.13
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 80.5
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 80.25
>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} Back     alignment and structure
Probab=99.50  E-value=3.3e-15  Score=137.76  Aligned_cols=79  Identities=32%  Similarity=0.523  Sum_probs=69.3

Q ss_pred             HHHHHHhcCCCEEEEEeCCCCCChHHHHHHHHHhccCCCccEEEEEcCCCCCChHHHHHHHHHHhcCCCeEEEecceeee
Q 037406            5 ECQRWAAKGINIRYESRENRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIALVQARWRFA   84 (162)
Q Consensus         5 ~v~~l~~~~~~v~~i~~~~~~G~KagAlN~gl~~a~~~~ge~i~i~DAD~~~~pd~L~~lv~~f~~dp~vg~V~~~~~~~   84 (162)
                      .++++.++ .++++++++++.++|++|+|.|++.+   +||||+++|+|++++||+|++++..|++||++++|+++..+.
T Consensus       204 ~l~~~~~~-~~v~~i~~~~~~~GKa~alN~gl~~a---~gd~Il~lDaD~~~~pd~L~~lv~~~~~dp~v~~V~~~~~~~  279 (802)
T 4hg6_A          204 ELQQLCRE-LGVVYSTRERNEHAKAGNMSAALERL---KGELVVVFDADHVPSRDFLARTVGYFVEDPDLFLVQTPHFFI  279 (802)
T ss_dssp             HHHHHHHH-HTCEEEECSSCCSHHHHHHHHHHHHC---CCSEEEECCTTEEECTTHHHHHHHHHHHSSSCCEEECCCCBS
T ss_pred             HHHHHHHh-cCcEEEEecCCCCcchHHHHHHHHhc---CCCEEEEECCCCCcChHHHHHHHHHHhcCCCeEEEeccEEEe
Confidence            34455443 46889998888677999999999999   999999999999999999999999998899999999998888


Q ss_pred             cCC
Q 037406           85 KEA   87 (162)
Q Consensus        85 N~~   87 (162)
                      |.+
T Consensus       280 ~~~  282 (802)
T 4hg6_A          280 NPD  282 (802)
T ss_dssp             SCC
T ss_pred             CCc
Confidence            765
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Back     alignment and structure
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Back     alignment and structure
>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 99.12
d1xhba2 328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.06
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 98.99
d2bo4a1 381 Mannosylglycerate synthase, MGS {Rhodothermus mari 96.5
d1fo8a_ 343 N-acetylglucosaminyltransferase I {Rabbit (Oryctol 91.42
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Spore coat polysaccharide biosynthesis protein SpsA
domain: Spore coat polysaccharide biosynthesis protein SpsA
species: Bacillus subtilis [TaxId: 1423]

Probab=99.12  E-value=4.3e-11  Score=92.21  Aligned_cols=79  Identities=14%  Similarity=0.193  Sum_probs=65.4

Q ss_pred             HHHHHHHhcCCCEEEEEeC--------CCCCChHHHHHHHHHhccCCCccEEEEEcCCCCCChHHHHHHHHHHhcCCCeE
Q 037406            4 QECQRWAAKGINIRYESRE--------NRTGYKAGALKEGLKRSYVKHCEYVAIFDVDFRLEPDYLRRAIPYLVQNSDIA   75 (162)
Q Consensus         4 ~~v~~l~~~~~~v~~i~~~--------~~~G~KagAlN~gl~~a~~~~ge~i~i~DAD~~~~pd~L~~lv~~f~~dp~vg   75 (162)
                      ++++++.. .+++++++.+        .+.| +++|+|.|++.+   +||||+++|+|+.+.|++|++++..|..+|+++
T Consensus        46 ~~l~~~~~-~~~i~~~~~~~~~~~~~~~~~g-~~~a~N~gi~~a---~g~~i~~lD~Dd~~~p~~l~~~~~~~~~~~~~~  120 (255)
T d1qg8a_          46 NVIRPFLN-DNRVRFYQSDISGVKERTEKTR-YAALINQAIEMA---EGEYITYATDDNIYMPDRLLKMVRELDTHPEKA  120 (255)
T ss_dssp             HHHGGGGG-STTEEEEECCCCSHHHHHSSCH-HHHHHHHHHHHC---CCSEEEEEETTEEECTTHHHHHHHHHHHCTTCC
T ss_pred             HHHHHhhh-hcccccccccccccccccccch-hccccccccccc---ccccccccccccccccchHHHHHHHHHhCCCCC
Confidence            45666654 4789988764        3344 899999999999   999999999999999999999999998899999


Q ss_pred             EEecceeeecCC
Q 037406           76 LVQARWRFAKEA   87 (162)
Q Consensus        76 ~V~~~~~~~N~~   87 (162)
                      +|.+.....+.+
T Consensus       121 ~v~~~~~~~~~~  132 (255)
T d1qg8a_         121 VIYSASKTYHLN  132 (255)
T ss_dssp             EEEEEEEEEEEC
T ss_pred             eEeecceeeeeC
Confidence            998876555443
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure