Citrus Sinensis ID: 037430

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MGRVIRAQRKGAGSVFKSHTHHRKGPAQFRSLDFGERNGYLKGVVAEIIHDPGRGAPLARVTFRHPFRYMKQKELFIAAEGMYTGQFVYCGKKATLMVGNVLPVRSIPEGAVVCNVEHHVGDRGVLARASGDYAVIISHNPDNDTTRVKLPSGAKKIIPSGCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWPK
ccccccccccccccccEEccccccccccccccccccccccccEEEEEEEEccccccccEEEEEcccccccccEEEEEEccccccccEEEEcccccccccccccccccccccEEEEEEECcccccCEECccccEEEEEECcccccCEEEEcccccEEEEcccccEEEEEECcccccccccHHHHHHccccccccccccc
**RV*R***********SHTHHRKGPAQFRSLDFGERNGYLKGVVAEIIHDPGRGAPLARVTFRHPFRYMKQKELFIAAEGMYTGQFVYCGKKATLMVGNVLPVRSIPEGAVVCNVEHHVGDRGVLARASGDYAVIISHNPDNDTTRVKLPSGAKKIIPSGCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRVIRAQRKGAGSVFKSHTHHRKGPAQFRSLDFGERNGYLKGVVAEIIHDPGRGAPLARVTFRHPFRYMKQKELFIAAEGMYTGQFVYCGKKATLMVGNVLPVRSIPEGAVVCNVEHHVGDRGVLARASGDYAVIISHNPDNDTTRVKLPSGAKKIIPSGCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L8-1 confidentP46286
60S ribosomal protein L8 probableQ9U9L2
60S ribosomal protein L8 probableP29766

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A17, chain A
Confidence level:very confident
Coverage over the Query: 2-198
View the alignment between query and template
View the model in PyMOL