Citrus Sinensis ID: 037449


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MAPKQPNTGLFVGLNKGYIVTKKELQPRSADRKGKTSKRVHFVRTVIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREIYRISFV
ccccccccccEEECccccECccccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHcc
*****PN*GLFVGLNKGYIVT*****************RVHFVRTVIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREIYRISFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKQPNTGLFVGLNKGYIVTKKELQPRSADRKGKTSKRVHFVRTVIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREIYRISFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L36 probableQ3T171
60S ribosomal protein L36-A probableQ92365
60S ribosomal protein L36 probableQ9Y3U8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A18, chain Q
Confidence level:very confident
Coverage over the Query: 7-97
View the alignment between query and template
View the model in PyMOL