Citrus Sinensis ID: 037470


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-----
MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDIDDSANAERNSGSAIDSKNNVDSNKGKGKRKLYVGTQSLGFRRDHMEVLSPLKDGVVVDWDIVDSIWDHAFRECLLIDPKEHPMLLAEPSSNTQQQRESSAFSFWVCVCGILVFCPVIEFDALVLTSFALGRATSLVVDCGGGSTTVAPVHDGYVLQKGVTTSPIGGEFLTNCLMKSLESKGITIKPRYSFKRKENRPGEFQIVDLDFPNTTESYKLYCQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQVIEIGADRFKTPDVLFNPSLVQTIPGMENFAENIPFRGLPQMVIDSINKCDVDIRRELFSSILLAGGTASMQQLKERLEKDLLEESPQAARVKVVSSGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKCP
ccccccccEEEEEcccccEEccccccccccEEEccccccccccccccccHHccccccccccccccccccccccccCEECccccccccccEEEccccccccccccHHHHHHHHHHHHHccccccccccEEEcccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHcccccEEEEEEcccccCEEEEEEcccccccccccccccccHHHHHHHHHHHHccccccccccEEEEcccccccEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEcccccEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHccEEEcccccccHHHHHHHHHHHHHHccccccEEEEEcccccccccccEEHHHHHcccccccccEEEHHHHccccccccccccc
MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMD*************************GKGKRKLYVGTQSLGFRRDHMEVLSPLKDGVVVDWDIVDSIWDHAFRECLLIDPKEHPMLLAEPSSNTQQQRESSAFSFWVCVCGILVFCPVIEFDALVLTSFALGRATSLVVDCGGGSTTVAPVHDGYVLQKGVTTSPIGGEFLTNCLMKSLESKGITIKPRYSFKRKENRPGEFQIVDLDFPNTTESYKLYCQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQVIEIGADRFKTPDVLFNPSLVQTIPGMENFAENIPFRGLPQMVIDSINKCDVDIRRELFSSILLAGGTASMQQLKERLEKDLLEESPQAARVKVVSSGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKCP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGGDEVSAIVIDLGSHTCKAGYAGEDAPKAVFPSVVGAIDQMDIDDSANAERNSGSAIDSKNNVDSNKGKGKRKLYVGTQSLGFRRDHMEVLSPLKDGVVVDWDIVDSIWDHAFRECLLIDPKEHPMLLAEPSSNTQQQRESSAFSFWVCVCGILVFCPVIEFDALVLTSFALGRATSLVVDCGGGSTTVAPVHDGYVLQKGVTTSPIGGEFLTNCLMKSLESKGITIKPRYSFKRKENRPGEFQIVDLDFPNTTESYKLYCQRVIASDIKECVCRAPDTPYDESAYSNIPMTPYELPDGQVIEIGADRFKTPDVLFNPSLVQTIPGMENFAENIPFRGLPQMVIDSINKCDVDIRRELFSSILLAGGTASMQQLKERLEKDLLEESPQAARVKVVSSGNATERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 4 Involved in several developmental processes including organization of plant organs, flowering time, anther development, flower senescence and fertility, probably by regulating the chromatin structure.confidentQ6ZJW9
Actin-related protein 4 Involved in several developmental processes including organization of plant organs, flowering time, anther development, flower senescence and fertility, probably by regulating the chromatin structure.confidentQ84M92
Actin-related protein 4 Involved in several developmental processes including organization of plant organs, flowering time, anther development, flower senescence and fertility, probably by regulating the chromatin structure.probableA2YR10

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QB0, chain A
Confidence level:very confident
Coverage over the Query: 3-43,72-332,344-445
View the alignment between query and template
View the model in PyMOL
Template: 3DWL, chain A
Confidence level:very confident
Coverage over the Query: 5-40,71-223,265-445
View the alignment between query and template
View the model in PyMOL