Citrus Sinensis ID: 037478

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSASELEKTENDQIQNIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE
ccccccccEEEEccccHHHHHHHHHcccccccEEcccccccccEEEEEEccEEEEEEEccccccHHHHHHHcHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccEEEEEEccccEEEEEEcccccccHHHHHccc
ccccccccEEEcccccHHHHHHHHHHcccEEEEEEEEcccccccEEEEcccHHHHHHcccccccEEEEEccHHHHccccccccccccccccEcHHHHHHHHcccccccccccccccccEEEEcccccEEEEEEccccccccHHHHccc
mklpdstsswvsksmnlnecrekcldnsscmaytnsdirgegsgcamwfGDLIDityfqdggqdLYIRMSASelektendqiqnidlelpLFELATIVSSTNNFSINmklgqggfgpvykgtlvdgQEIAVKRLSKISEQGLKELKNE
mklpdstsswvSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSASELEKTENDQIQNIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKiseqglkelkne
MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSASELEKTENDQIQNIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE
*******************CREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSAS*******DQIQNIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKR***************
MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSASELEKTENDQIQNIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKN*
************KSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSASELEKTENDQIQNIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE
*KLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSASELEK*******NIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLS*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQDGGQDLYIRMSASELEKTENDQIQNIDLELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
O81832 783 G-type lectin S-receptor- yes no 1.0 0.189 0.529 1e-43
O81833 815 G-type lectin S-receptor- no no 1.0 0.181 0.425 1e-33
Q9S972 847 Receptor-like serine/thre no no 1.0 0.174 0.364 5e-31
Q09092 857 Putative serine/threonine N/A no 1.0 0.172 0.367 2e-27
Q9SXB4 820 G-type lectin S-receptor- no no 0.952 0.171 0.368 4e-24
O64778 807 G-type lectin S-receptor- no no 0.878 0.161 0.383 6e-24
O64780 814 G-type lectin S-receptor- no no 0.959 0.174 0.373 5e-23
O64783 814 G-type lectin S-receptor- no no 0.878 0.159 0.368 6e-23
O64782 805 G-type lectin S-receptor- no no 0.878 0.161 0.374 2e-22
Q9SXB5 820 G-type lectin S-receptor- no no 0.945 0.170 0.356 4e-22
>sp|O81832|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 OS=Arabidopsis thaliana GN=At4g27290 PE=3 SV=4 Back     alignment and function desciption
 Score =  174 bits (442), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/155 (52%), Positives = 111/155 (71%), Gaps = 7/155 (4%)

Query: 1   MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQD 60
           +KLPD+ +SW  K+M+LNEC++ CL N +C AY+  DIR  G GC +WFGDLIDI  + +
Sbjct: 355 LKLPDTRTSWYDKNMDLNECKKVCLRNCTCSAYSPFDIRDGGKGCILWFGDLIDIREYNE 414

Query: 61  GGQDLYIRMSASELE-------KTENDQIQNIDLELPLFELATIVSSTNNFSINMKLGQG 113
            GQDLY+R+++SE+E       +  + + +  DLELP  +L T+  +T+ FS   KLGQG
Sbjct: 415 NGQDLYVRLASSEIETLQRESSRVSSRKQEEEDLELPFLDLDTVSEATSGFSAGNKLGQG 474

Query: 114 GFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE 148
           GFGPVYKGTL  GQE+AVKRLS+ S QG++E KNE
Sbjct: 475 GFGPVYKGTLACGQEVAVKRLSRTSRQGVEEFKNE 509

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O81833|SD11_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 OS=Arabidopsis thaliana GN=SD11 PE=1 SV=1 Back     alignment and function description
>sp|Q9S972|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6 OS=Arabidopsis thaliana GN=SD16 PE=1 SV=2 Back     alignment and function description
>sp|Q09092|SRK6_BRAOE Putative serine/threonine-protein kinase receptor OS=Brassica oleracea var. acephala GN=SRK6 PE=2 SV=2 Back     alignment and function description
>sp|Q9SXB4|Y1130_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300 OS=Arabidopsis thaliana GN=At1g11300 PE=2 SV=1 Back     alignment and function description
>sp|O64778|Y1142_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61420 OS=Arabidopsis thaliana GN=At1g61420 PE=2 SV=2 Back     alignment and function description
>sp|O64780|Y1614_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61400 OS=Arabidopsis thaliana GN=At1g61400 PE=2 SV=4 Back     alignment and function description
>sp|O64783|Y1137_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61370 OS=Arabidopsis thaliana GN=At1g61370 PE=3 SV=2 Back     alignment and function description
>sp|O64782|SD129_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-29 OS=Arabidopsis thaliana GN=SD129 PE=1 SV=1 Back     alignment and function description
>sp|Q9SXB5|Y1135_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11305 OS=Arabidopsis thaliana GN=At1g11305 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
224113157 786 predicted protein [Populus trichocarpa] 1.0 0.188 0.692 6e-53
224113153 785 predicted protein [Populus trichocarpa] 1.0 0.188 0.697 3e-52
224115138 500 predicted protein [Populus trichocarpa] 1.0 0.296 0.645 5e-52
356545219 855 PREDICTED: G-type lectin S-receptor-like 1.0 0.173 0.633 6e-50
356546914 788 PREDICTED: G-type lectin S-receptor-like 1.0 0.187 0.593 1e-49
359493721 804 PREDICTED: G-type lectin S-receptor-like 0.993 0.182 0.644 1e-47
356530645 783 PREDICTED: G-type lectin S-receptor-like 0.993 0.187 0.606 2e-47
356545293 777 PREDICTED: receptor-like serine/threonin 1.0 0.190 0.594 5e-47
224115124 768 predicted protein [Populus trichocarpa] 1.0 0.192 0.606 3e-46
224122846 771 predicted protein [Populus trichocarpa] 1.0 0.191 0.593 2e-45
>gi|224113157|ref|XP_002332644.1| predicted protein [Populus trichocarpa] gi|222832839|gb|EEE71316.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 121/153 (79%), Gaps = 5/153 (3%)

Query: 1   MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQD 60
           +K PD+T SW++KSMNLNECR KCL N SCMAY+NSD+RG GSGC +W+GDLIDI  F  
Sbjct: 361 LKWPDATHSWLNKSMNLNECRAKCLQNCSCMAYSNSDVRGGGSGCIIWYGDLIDIRQFPA 420

Query: 61  GGQDLYIRMSASELEKT--ENDQI---QNIDLELPLFELATIVSSTNNFSINMKLGQGGF 115
           GGQ+LYIRM+ SE  +   +NDQI   +N DLELP FE A IV++TNNFSI  KLGQGGF
Sbjct: 421 GGQELYIRMNPSESAEMDQQNDQITDGENEDLELPQFEFAKIVNATNNFSIKNKLGQGGF 480

Query: 116 GPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE 148
           GPVYKGTL DGQEIAVKRLS  S QG KE KNE
Sbjct: 481 GPVYKGTLEDGQEIAVKRLSMSSRQGSKEFKNE 513

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224113153|ref|XP_002332643.1| predicted protein [Populus trichocarpa] gi|222832838|gb|EEE71315.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115138|ref|XP_002316952.1| predicted protein [Populus trichocarpa] gi|222860017|gb|EEE97564.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356545219|ref|XP_003541042.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Back     alignment and taxonomy information
>gi|356546914|ref|XP_003541865.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Back     alignment and taxonomy information
>gi|359493721|ref|XP_002280717.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356530645|ref|XP_003533891.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Back     alignment and taxonomy information
>gi|356545293|ref|XP_003541078.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7-like [Glycine max] Back     alignment and taxonomy information
>gi|224115124|ref|XP_002316947.1| predicted protein [Populus trichocarpa] gi|222860012|gb|EEE97559.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122846|ref|XP_002330378.1| predicted protein [Populus trichocarpa] gi|222871763|gb|EEF08894.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2131684 783 AT4G27290 [Arabidopsis thalian 1.0 0.189 0.535 5.9e-41
TAIR|locus:2141181 850 RK3 "receptor kinase 3" [Arabi 0.533 0.092 0.493 1.4e-37
TAIR|locus:2018546 843 RK1 "receptor kinase 1" [Arabi 0.662 0.116 0.39 1.6e-36
TAIR|locus:2131694 815 AT4G27300 [Arabidopsis thalian 0.506 0.092 0.480 5.1e-34
TAIR|locus:2197744 807 AT1G61420 [Arabidopsis thalian 0.547 0.100 0.536 1.8e-26
TAIR|locus:2200151 830 SD1-13 "S-domain-1 13" [Arabid 0.412 0.073 0.639 4.7e-25
TAIR|locus:2141176 849 B120 [Arabidopsis thaliana (ta 0.412 0.071 0.622 6.6e-25
TAIR|locus:2197734 814 AT1G61370 [Arabidopsis thalian 0.412 0.074 0.622 1.1e-24
TAIR|locus:2197664 804 AT1G61490 [Arabidopsis thalian 0.405 0.074 0.633 3.8e-24
TAIR|locus:2197714 792 AT1G61440 [Arabidopsis thalian 0.466 0.087 0.591 9.4e-24
TAIR|locus:2131684 AT4G27290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 442 (160.7 bits), Expect = 5.9e-41, P = 5.9e-41
 Identities = 83/155 (53%), Positives = 113/155 (72%)

Query:     1 MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDITYFQD 60
             +KLPD+ +SW  K+M+LNEC++ CL N +C AY+  DIR  G GC +WFGDLIDI  + +
Sbjct:   355 LKLPDTRTSWYDKNMDLNECKKVCLRNCTCSAYSPFDIRDGGKGCILWFGDLIDIREYNE 414

Query:    61 GGQDLYIRMSASELE--KTENDQI-----QNIDLELPLFELATIVSSTNNFSINMKLGQG 113
              GQDLY+R+++SE+E  + E+ ++     +  DLELP  +L T+  +T+ FS   KLGQG
Sbjct:   415 NGQDLYVRLASSEIETLQRESSRVSSRKQEEEDLELPFLDLDTVSEATSGFSAGNKLGQG 474

Query:   114 GFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE 148
             GFGPVYKGTL  GQE+AVKRLS+ S QG++E KNE
Sbjct:   475 GFGPVYKGTLACGQEVAVKRLSRTSRQGVEEFKNE 509
GO:0004672 "protein kinase activity" evidence=IEA;ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0048544 "recognition of pollen" evidence=IEA
GO:0048765 "root hair cell differentiation" evidence=RCA
TAIR|locus:2141181 RK3 "receptor kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018546 RK1 "receptor kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131694 AT4G27300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197744 AT1G61420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200151 SD1-13 "S-domain-1 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141176 B120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197734 AT1G61370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197664 AT1G61490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197714 AT1G61440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
pfam0827666 pfam08276, PAN_2, PAN-like domain 2e-23
cd0109884 cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain 2e-20
smart0047378 smart00473, PAN_AP, divergent subfamily of APPLE d 3e-10
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 5e-06
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 6e-06
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 5e-05
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-04
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-04
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-04
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-04
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-04
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 6e-04
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 0.001
cd05058 262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 0.001
pfam0827771 pfam08277, PAN_3, PAN-like domain 0.001
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 0.001
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 0.002
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.002
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 0.003
PLN03225 566 PLN03225, PLN03225, Serine/threonine-protein kinas 0.003
cd08224 267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 0.003
>gnl|CDD|219774 pfam08276, PAN_2, PAN-like domain Back     alignment and domain information 
 Score = 86.2 bits (214), Expect = 2e-23
 Identities = 30/55 (54%), Positives = 42/55 (76%), Gaps = 1/55 (1%)

Query: 1  MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDI 55
          MKLPD+T++ V +S+ L EC ++CL N SC AY  +DIRG GSGC +W G+L+D+
Sbjct: 13 MKLPDTTAAIVDRSIGLKECEQRCLSNCSCTAYAYADIRG-GSGCLIWTGELVDM 66

Length = 66
>gnl|CDD|238531 cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins Back     alignment and domain information
>gnl|CDD|214680 smart00473, PAN_AP, divergent subfamily of APPLE domains Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|219775 pfam08277, PAN_3, PAN-like domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
PF0827666 PAN_2: PAN-like domain; InterPro: IPR013227 PAN do 99.68
cd0012980 PAN_APPLE PAN/APPLE-like domain; present in N-term 99.59
cd0109884 PAN_AP_plant Plant PAN/APPLE-like domain; present 99.53
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.3
smart0047378 PAN_AP divergent subfamily of APPLE domains. Apple 98.83
PLN03224 507 probable serine/threonine protein kinase; Provisio 97.82
cd0110073 APPLE_Factor_XI_like Subfamily of PAN/APPLE-like d 97.79
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 97.45
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 97.39
KOG3653 534 consensus Transforming growth factor beta/activin 97.31
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 97.09
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 97.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 96.88
PTZ00284 467 protein kinase; Provisional 96.85
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 96.82
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 96.8
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 96.79
PRK09188 365 serine/threonine protein kinase; Provisional 96.78
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 96.74
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 96.69
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 96.67
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 96.63
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 96.55
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 96.53
cd05144 198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 96.53
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 96.53
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 96.45
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 96.43
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 96.4
KOG0192 362 consensus Tyrosine kinase specific for activated ( 96.38
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 96.36
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 96.3
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 96.3
PHA02988 283 hypothetical protein; Provisional 96.29
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 96.29
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 96.28
PTZ00283 496 serine/threonine protein kinase; Provisional 96.23
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 96.23
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 96.21
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 96.21
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 96.16
PTZ00036 440 glycogen synthase kinase; Provisional 96.16
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 96.14
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 96.14
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 96.13
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 96.13
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 96.13
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 96.11
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 96.08
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 96.06
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 96.05
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 96.04
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.03
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 95.98
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 95.98
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 95.98
KOG2052 513 consensus Activin A type IB receptor, serine/threo 95.9
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 95.9
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 95.85
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 95.82
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 95.73
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 95.72
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 95.67
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 95.64
PLN00034 353 mitogen-activated protein kinase kinase; Provision 95.64
smart00090 237 RIO RIO-like kinase. 95.64
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 95.61
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 95.59
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 95.59
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 95.59
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 95.57
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 95.51
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 95.49
KOG0605 550 consensus NDR and related serine/threonine kinases 95.48
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 95.45
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 95.44
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 95.43
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 95.42
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 95.4
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 95.37
KOG0201 467 consensus Serine/threonine protein kinase [Signal 95.36
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 95.35
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 95.35
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 95.35
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 95.34
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 95.34
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 95.34
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 95.31
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 95.3
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 95.28
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 95.28
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 95.25
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 95.22
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 95.19
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 95.17
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 95.17
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 95.16
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 95.15
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 95.15
PTZ00263 329 protein kinase A catalytic subunit; Provisional 95.12
PHA02882 294 putative serine/threonine kinase; Provisional 95.12
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 95.11
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 95.11
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 95.1
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 95.09
KOG0577 948 consensus Serine/threonine protein kinase [Signal 95.07
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 95.02
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 95.0
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 95.0
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 95.0
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 94.98
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 94.94
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 94.94
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 94.91
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 94.89
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 94.88
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 94.87
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 94.86
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 94.85
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 94.84
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 94.84
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 94.83
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 94.73
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 94.63
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 94.6
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 94.58
KOG0661 538 consensus MAPK related serine/threonine protein ki 94.53
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 94.48
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 94.43
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 94.42
PF1429551 PAN_4: PAN domain; PDB: 2YIL_E 2YIP_C 2YIO_A. 94.4
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 94.39
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 94.35
KOG0694 694 consensus Serine/threonine protein kinase [Signal 94.34
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 94.32
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 94.31
KOG0575 592 consensus Polo-like serine/threonine protein kinas 94.3
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 94.3
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 94.24
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 94.24
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 94.22
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 94.21
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 94.15
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 94.13
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 94.12
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 94.11
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 94.09
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 94.08
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 94.05
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 94.03
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 94.03
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 94.02
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 94.01
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 94.01
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 93.99
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 93.98
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 93.98
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 93.95
smart0022379 APPLE APPLE domain. Four-fold repeat in plasma kal 93.94
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 93.94
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 93.94
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 93.84
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 93.82
PHA03209 357 serine/threonine kinase US3; Provisional 93.8
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 93.78
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 93.7
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 93.65
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 93.62
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 93.59
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 93.54
KOG1989 738 consensus ARK protein kinase family [Signal transd 93.53
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 93.46
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 93.4
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 93.39
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 93.35
KOG0198 313 consensus MEKK and related serine/threonine protei 93.33
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 93.32
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 93.22
PF0002479 PAN_1: PAN domain This Prosite entry concerns appl 93.18
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 93.13
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 93.13
PHA03212 391 serine/threonine kinase US3; Provisional 93.11
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 93.08
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 93.07
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 93.05
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 92.94
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 92.79
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 92.78
KOG0598 357 consensus Ribosomal protein S6 kinase and related 92.6
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 92.58
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 92.32
PTZ00024 335 cyclin-dependent protein kinase; Provisional 92.28
PHA03211 461 serine/threonine kinase US3; Provisional 91.95
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 91.93
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 91.64
KOG0583 370 consensus Serine/threonine protein kinase [Signal 91.51
COG0661 517 AarF Predicted unusual protein kinase [General fun 91.44
cd0109980 PAN_AP_HGF Subfamily of PAN/APPLE-like domains; pr 91.14
PTZ00267 478 NIMA-related protein kinase; Provisional 90.94
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 90.93
PTZ00266 1021 NIMA-related protein kinase; Provisional 90.77
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 90.75
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 90.64
PF0827771 PAN_3: PAN-like domain; InterPro: IPR006583 PAN do 90.23
KOG0581 364 consensus Mitogen-activated protein kinase kinase 90.09
PRK09605 535 bifunctional UGMP family protein/serine/threonine 90.01
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 89.73
KOG0582 516 consensus Ste20-like serine/threonine protein kina 89.68
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 89.64
smart0060594 CW CW domain. 89.49
PHA03207 392 serine/threonine kinase US3; Provisional 89.19
KOG1167 418 consensus Serine/threonine protein kinase of the C 89.14
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 88.67
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 88.44
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 88.1
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 87.95
KOG4721 904 consensus Serine/threonine protein kinase, contain 87.71
KOG0578 550 consensus p21-activated serine/threonine protein k 87.25
KOG1235 538 consensus Predicted unusual protein kinase [Genera 87.22
PRK10359 232 lipopolysaccharide core biosynthesis protein; Prov 87.18
KOG1027 903 consensus Serine/threonine protein kinase and endo 86.68
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 85.92
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 84.41
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 82.6
>PF08276 PAN_2: PAN-like domain; InterPro: IPR013227 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions [] Back     alignment and domain information 
Probab=99.68  E-value=3.7e-17  Score=99.35  Aligned_cols=54  Identities=48%  Similarity=1.058  Sum_probs=45.8

Q ss_pred             CCCCCCcceeeeccCChhHHHHHhccCCCcceeeccccCCCCcceEEEeccccce
Q 037478            1 MKLPDSTSSWVSKSMNLNECREKCLDNSSCMAYTNSDIRGEGSGCAMWFGDLIDI   55 (148)
Q Consensus         1 v~lp~~~~~~~~~~~~~~~C~~~Cl~nCsC~a~~~~~~~~~~~~C~~~~~~l~~~   55 (148)
                      |+||+++...+..+.++++|+..||+||||+||+|.+.. ++++|++|.++|+|+
T Consensus        13 ~~~p~~~~~~~~~~~s~~~C~~~Cl~nCsC~Ayay~~~~-~~~~C~lW~~~L~d~   66 (66)
T PF08276_consen   13 MKLPDFDNAIVDSSVSLEECEKACLSNCSCTAYAYSNLS-GGGGCLLWYGDLVDL   66 (66)
T ss_pred             eeCCCCcceeeecCCCHHHHHhhcCCCCCEeeEEeeccC-CCCEEEEEcCEeecC
Confidence            578998776566779999999999999999999997644 557899999999874

These domains contain a hair-pin loop like structure, similar to knottins, but the pattern of disulphide bonds differs
>cd00129 PAN_APPLE PAN/APPLE-like domain; present in N-terminal (N) domains of plasminogen/ hepatocyte growth factor proteins, plasma prekallikrein/coagulation factor XI and microneme antigen proteins, plant receptor-like protein kinases, and various nematode and leech anti-platelet proteins Back     alignment and domain information
>cd01098 PAN_AP_plant Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00473 PAN_AP divergent subfamily of APPLE domains Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd01100 APPLE_Factor_XI_like Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>PF14295 PAN_4: PAN domain; PDB: 2YIL_E 2YIP_C 2YIO_A Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>smart00223 APPLE APPLE domain Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF00024 PAN_1: PAN domain This Prosite entry concerns apple domains, a subset of PAN domains; InterPro: IPR003014 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions [] Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>cd01099 PAN_AP_HGF Subfamily of PAN/APPLE-like domains; present in N-terminal (N) domains of plasminogen/hepatocyte growth factor proteins, and various proteins found in Bilateria, such as leech anti-platelet proteins Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF08277 PAN_3: PAN-like domain; InterPro: IPR006583 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions [] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>smart00605 CW CW domain Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-07
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 8e-07
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 8e-07
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 9e-07
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 3e-04
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 3e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (62%)
Query: 88  ELPLFELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQG 141
           +L  F L  +  +++NFS    LG+GGFG VYKG L DG  +AVKRL +   QG
Sbjct: 24  QLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQG 77
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 4e-22
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 8e-21
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 2e-19
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 3e-10
3soc_A 322 Activin receptor type-2A; structural genomics cons 7e-10
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-07
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-07
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 6e-07
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 7e-07
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 9e-07
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-06
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-06
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 7e-06
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 8e-06
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 9e-06
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 9e-06
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 1e-05
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-05
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 1e-05
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-05
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 2e-05
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-05
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 2e-05
2a19_B 284 Interferon-induced, double-stranded RNA-activated 2e-05
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 4e-05
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 6e-05
3q4u_A 301 Activin receptor type-1; structural genomics conso 6e-05
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 7e-05
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 8e-05
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 9e-05
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 9e-05
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-04
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 1e-04
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-04
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 2e-04
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-04
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-04
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-04
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 3e-04
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 3e-04
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 3e-04
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-04
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-04
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 3e-04
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-04
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 4e-04
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 4e-04
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-04
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 5e-04
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 5e-04
4aoj_A 329 High affinity nerve growth factor receptor; transf 5e-04
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 6e-04
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 6e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score = 88.8 bits (221), Expect = 4e-22
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 92  FELATIVSSTNNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE 148
             L  +  +TNNF     +G G FG VYKG L DG ++A+KR +  S QG++E + E
Sbjct: 29  VPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETE 85
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 98.22
4aoj_A 329 High affinity nerve growth factor receptor; transf 98.21
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 98.18
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 98.11
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 98.06
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.97
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 97.95
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 97.67
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.6
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 97.57
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 97.57
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 97.52
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 97.47
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 97.46
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 97.44
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 97.41
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 97.36
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 97.34
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 97.32
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 97.31
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 97.31
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 97.29
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 97.27
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 97.24
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 97.24
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 97.22
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 97.19
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 97.18
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 97.16
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 97.15
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 97.15
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 97.14
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 97.11
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 97.11
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 97.09
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 97.08
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.07
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 97.06
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 97.01
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 97.01
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 97.0
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 97.0
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 96.98
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 96.98
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 96.96
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 96.95
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 96.95
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 96.94
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 96.93
3niz_A 311 Rhodanese family protein; structural genomics, str 96.93
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 96.93
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 96.92
3soc_A 322 Activin receptor type-2A; structural genomics cons 96.9
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 96.89
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 96.89
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 96.88
3q4u_A 301 Activin receptor type-1; structural genomics conso 96.87
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 96.86
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 96.86
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 96.8
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 96.79
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 96.78
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 96.75
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 96.75
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 96.75
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 96.74
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 96.74
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 96.73
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 96.72
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 96.71
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 96.71
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 96.7
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 96.7
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 96.69
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 96.69
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 96.67
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 96.65
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 96.65
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 96.64
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 96.62
3uqc_A 286 Probable conserved transmembrane protein; structur 96.61
2a19_B 284 Interferon-induced, double-stranded RNA-activated 96.6
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 96.6
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 96.6
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 96.6
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 96.59
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 96.59
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 96.57
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 96.57
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 96.56
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 96.54
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 96.54
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 96.54
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 96.54
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 96.52
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 96.52
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 96.52
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 96.52
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 96.51
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 96.51
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 96.51
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 96.49
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 96.48
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 96.46
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 96.46
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 96.46
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 96.45
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 96.44
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 96.43
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 96.43
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 96.41
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 96.41
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 96.41
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 96.41
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 96.4
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 96.39
3an0_A 340 Dual specificity mitogen-activated protein kinase; 96.39
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 96.38
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 96.36
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 96.36
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 96.35
3rp9_A 458 Mitogen-activated protein kinase; structural genom 96.35
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 96.35
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 96.35
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 96.34
3fme_A 290 Dual specificity mitogen-activated protein kinase; 96.34
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 96.32
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 96.31
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 96.3
3ork_A 311 Serine/threonine protein kinase; structural genomi 96.3
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 96.29
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 96.28
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 96.27
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 96.25
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 96.24
3bhy_A 283 Death-associated protein kinase 3; death associate 96.24
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 96.22
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 96.22
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 96.22
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 96.21
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 96.21
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 96.21
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 96.2
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 96.2
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 96.2
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 96.19
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 96.19
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 96.19
3aln_A 327 Dual specificity mitogen-activated protein kinase; 96.18
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 96.18
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 96.18
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 96.17
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 96.17
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 96.16
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 96.16
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 96.16
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 96.15
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 96.15
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 96.15
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 96.14
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 96.14
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 96.13
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 96.13
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 96.12
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 96.12
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 96.12
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 96.12
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 96.12
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 96.1
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 96.1
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 96.1
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 96.09
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 96.09
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 96.07
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 96.07
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 96.06
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 96.06
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 96.06
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 96.06
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 96.05
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 96.05
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 96.04
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 96.03
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 96.02
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 96.02
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 96.01
2dyl_A 318 Dual specificity mitogen-activated protein kinase 96.01
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 96.01
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 96.0
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 95.96
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 95.96
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 95.95
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 95.95
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 95.94
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 95.94
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 95.92
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 95.88
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 95.88
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 95.86
3pls_A 298 Macrophage-stimulating protein receptor; protein k 95.86
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 95.84
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 95.84
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 95.82
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 95.81
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 95.8
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 95.8
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 95.8
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 95.78
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 95.78
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 95.77
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 95.74
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 95.74
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 95.73
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 95.73
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 95.73
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 95.66
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 95.65
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 95.65
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 95.64
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 95.64
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 95.62
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 95.61
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 95.59
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 95.56
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 95.54
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 95.52
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 95.51
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 95.5
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 95.49
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 95.49
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 95.47
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 95.46
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 95.43
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 95.41
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 95.36
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 95.35
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 95.34
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 95.31
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 95.22
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 95.15
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 95.0
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 94.99
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 94.94
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 94.81
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 94.77
2ll3_A82 Micronemal protein 4; cell adhesion; NMR {Toxoplas 94.73
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 93.55
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 89.42
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 88.43
3hms_A101 Hepatocyte growth factor; HGF/SF, hormone/growth f 85.25
4a5v_A161 MIC4, micronemal protein 4; adhesion; NMR {Toxopla 81.4
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 81.37
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
Probab=98.22  E-value=4.4e-07  Score=69.30  Aligned_cols=41  Identities=37%  Similarity=0.592  Sum_probs=29.8

Q ss_pred             ceeccCCCccEEEEEEc------CCcEEEEEEecccC-ccchhhhhcC
Q 037478          108 MKLGQGGFGPVYKGTLV------DGQEIAVKRLSKIS-EQGLKELKNE  148 (148)
Q Consensus       108 ~~lg~G~fG~Vykg~l~------~g~~vavK~l~~~~-~~~~~ef~~E  148 (148)
                      ++||+|+||.||+|.+.      +++.||||++.... ....++|.+|
T Consensus        32 ~~lG~G~fG~Vykg~~~~~~~~~~~~~VAvK~l~~~~~~~~~~~f~~E   79 (308)
T 4gt4_A           32 EELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHE   79 (308)
T ss_dssp             EEEEECSSCEEEEEEEC-------CEEEEEEECCC-CCC-CHHHHHHH
T ss_pred             eEeccCCCcEEEEEEEcCCccCCCCeEEEEEEECcccChHHHHHHHHH
Confidence            78999999999999873      46789999996532 2234567654
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2ll3_A Micronemal protein 4; cell adhesion; NMR {Toxoplasma gondii} PDB: 2ll4_M* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3hms_A Hepatocyte growth factor; HGF/SF, hormone/growth factor, disulfide bond, glycoprotein, kringle, pyrrolidone carboxylic acid, serine protea homolog; 1.70A {Homo sapiens} SCOP: g.10.1.1 PDB: 3hmt_A 2hgf_A 3hmr_A Back     alignment and structure
>4a5v_A MIC4, micronemal protein 4; adhesion; NMR {Toxoplasma gondii} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 6e-11
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-10
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-10
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 4e-10
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-09
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-09
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-09
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-09
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 6e-09
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 7e-09
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-08
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-08
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-08
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-08
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-08
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-08
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 4e-08
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-08
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 6e-08
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 6e-08
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 8e-08
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-08
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 9e-08
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-07
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-07
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-07
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-07
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-07
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-07
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-07
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-07
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-07
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-07
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-07
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-07
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-07
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-07
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-07
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 5e-07
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-07
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 6e-07
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 6e-07
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 6e-07
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-07
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 8e-07
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 9e-07
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-06
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-06
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-06
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-06
d1zara2 191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-06
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-06
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-06
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-06
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-06
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 4e-06
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 5e-06
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 6e-06
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 7e-06
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-05
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-05
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 6e-05
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-04
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.2 bits (135), Expect = 6e-11
 Identities = 9/47 (19%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 102 NNFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE 148
           +  +   ++G G FG V+ G  ++  ++A+K + +      ++   E
Sbjct: 5   SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIRE-GAMSEEDFIEE 50
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.28
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 98.28
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 98.18
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.15
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.12
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 98.08
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 97.96
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 97.89
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 97.86
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 97.78
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 97.71
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 97.68
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 97.68
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 97.67
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 97.62
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 97.61
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 97.61
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 97.61
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 97.6
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 97.58
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 97.55
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 97.53
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 97.51
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 97.51
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 97.49
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 97.48
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 97.48
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 97.47
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 97.47
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 97.46
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 97.44
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 97.4
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 97.39
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 97.39
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 97.37
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 97.36
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 97.35
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 97.35
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 97.32
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 97.31
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 97.3
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 97.24
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 97.23
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 97.21
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 97.17
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 97.17
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 97.17
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 97.13
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 97.1
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 97.01
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 97.0
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 96.98
d2qj2a191 Hepatocyte growth factor {Human (Homo sapiens) [Ta 93.71
d1dmca_31 Metallothionein {Crab (Callinectes sapidus), alpha 81.88
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.28  E-value=2.2e-07  Score=67.36  Aligned_cols=45  Identities=20%  Similarity=0.436  Sum_probs=35.2

Q ss_pred             cccccceeccCCCccEEEEEEcCCcEEEEEEecccCccchhhhhcC
Q 037478          103 NFSINMKLGQGGFGPVYKGTLVDGQEIAVKRLSKISEQGLKELKNE  148 (148)
Q Consensus       103 ~f~~~~~lg~G~fG~Vykg~l~~g~~vavK~l~~~~~~~~~ef~~E  148 (148)
                      +|...+.||+|+||.||+|.+.++..||||++.. .....++|.+|
T Consensus         6 ~~~~~~~iG~G~fg~Vy~~~~~~~~~vAvK~i~~-~~~~~~~~~~E   50 (263)
T d1sm2a_           6 ELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIRE-GAMSEEDFIEE   50 (263)
T ss_dssp             CEEEEEEEECCSSCCEEEEEETTTEEEEEEECCS-SSSCHHHHHHH
T ss_pred             HcEEEEEEeeCCCeEEEEEEECCCCEEEEEEECC-CcCcHHHHHHH
Confidence            4556689999999999999998889999999965 33344556543
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qj2a1 g.10.1.1 (A:36-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dmca_ g.46.1.1 (A:) Metallothionein {Crab (Callinectes sapidus), alpha and beta domains [TaxId: 6763]} Back     information, alignment and structure