Citrus Sinensis ID: 037479


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MELGSVLEFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADAKSATVRFHNEIIGKDLFRVLKEKNGTHLNALISEKITLVPGDITREDLGVKDSNLREEMWNKLDVVINLAATTNFDERYDVALDLNTFGAKHVLNFSKKCAKLIVLVHVSTAFVWGEESGMLYESSFKMGDTLNGASGLDIDVERQVVEQELNELQAEGASEEAITLAMKDLGIKRAKIYGWPNTYVFTKVMGEMFIEHLKENMSVAIVRPTIITGTYKEPFPGWAEGIRTIDSLAVGYGKGRLTCFLGDVKGIVDVIPADMVVNAIVVAVVAHAKQPSDVNNIYQVGSSLRNPLIYTNLQDYAYRYFTKKPWINKDGKPVKVGKITVFHDMASFYRYMTVRYILPLKGLELANAAFCKYFQSKYNDLNRKINFVMRLVELYRPYLFFGGIFDDKNTEKLRLVARDNGVETDIFYFDPKCIDWEDYFINTHIPGIVKYAFK
ccccHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHccHHHHHHHHHHccccHHHHccccEEEECcccccccccccHHHHHHHHccHHHHEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHccccccHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHccccccccccCECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCEEEEECcccHHHHHHHHccccccccccccccccccHHHHHHHccHHHHHHHHcc
***GSVLEFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADAKSATVRFHNEIIGKDLFRVLKEKNGTHLNALISEKITLVPGDITREDLGVKDSNLREEMWNKLDVVINLAATTNFDERYDVALDLNTFGAKHVLNFSKKCAKLIVLVHVSTAFVWGEESGMLYESSFKMGDTLNGASGLDIDVERQVVEQELNELQAEGASEEAITLAMKDLGIKRAKIYGWPNTYVFTKVMGEMFIEHLKENMSVAIVRPTIITGTYKEPFPGWAEGIRTIDSLAVGYGKGRLTCFLGDVKGIVDVIPADMVVNAIVVAVVAHAKQPSDVNNIYQVGSSLRNPLIYTNLQDYAYRYFTKKPWINKDGKPVKVGKITVFHDMASFYRYMTVRYILPLKGLELANAAFCKYFQSKYNDLNRKINFVMRLVELYRPYLFFGGIFDDKNTEKLRLVARDNGVETDIFYFDPKCIDWEDYFINTHIPGIVKYAFK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELGSVLEFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRAADAKSATVRFHNEIIGKDLFRVLKEKNGTHLNALISEKITLVPGDITREDLGVKDSNLREEMWNKLDVVINLAATTNFDERYDVALDLNTFGAKHVLNFSKKCAKLIVLVHVSTAFVWGEESGMLYESSFKMGDTLNGASGLDIDVExxxxxxxxxxxxxxxxxxxxxTLAMKDLGIKRAKIYGWPNTYVFTKVMGEMFIEHLKENMSVAIVRPTIITGTYKEPFPGWAEGIRTIDSLAVGYGKGRLTCFLGDVKGIVDVIPADMVVNAIVVAVVAHAKQPSDVNNIYQVGSSLRNPLIYTNLQDYAYRYFTKKPWINKDGKPVKVGKITVFHDMASFYRYMTVRYILPLKGLELANAAFCKYFQSKYNDLNRKINFVMRLVELYRPYLFFGGIFDDKNTEKLRLVARDNGVETDIFYFDPKCIDWEDYFINTHIPGIVKYAFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Fatty acyl-CoA reductase 3 Catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C24:0 and C26:0. May be unable to use saturated and monounsaturated C16 and C18 acyl-CoA as substrates. Involved in cuticular wax formation.probableQ93ZB9
Alcohol-forming fatty acyl-CoA reductase NADPH-dependent alcohol-forming fatty acyl-coenzyme A reductase that catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The recombinant enzyme accepts saturated and mono-unsaturated fatty acyl-CoAs of 16 to 22 carbons.probableQ9XGY7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.2.-.-Acting on the aldehyde or oxo group of donors.probable
1.2.1.-With NAD(+) or NADP(+) as acceptor.probable
1.2.1.n2Fatty acyl-CoA reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DQV, chain A
Confidence level:very confident
Coverage over the Query: 10-179,193,222-361
View the alignment between query and template
View the model in PyMOL
Template: 1Y1P, chain A
Confidence level:confident
Coverage over the Query: 6-180,192-193,216-362
View the alignment between query and template
View the model in PyMOL