Citrus Sinensis ID: 037487

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MVFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMKEEAA
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
*VFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLR**********KLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMKEEAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Non-symbiotic hemoglobin 2 May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has a low affinity for O(2).confidentO24521
Non-symbiotic hemoglobin 1 May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O(2) because of a very low dissociation constant.probableO04986
Non-symbiotic hemoglobin 2 May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule.probableQ941Q2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OIF, chain A
Confidence level:very confident
Coverage over the Query: 2-149
View the alignment between query and template
View the model in PyMOL