Citrus Sinensis ID: 037487
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 151 | ||||||
| 297833826 | 159 | non-symbiotic hemoglobin 2 [Arabidopsis | 0.973 | 0.924 | 0.721 | 1e-54 | |
| 22001642 | 161 | RecName: Full=Non-symbiotic hemoglobin 2 | 0.986 | 0.925 | 0.712 | 7e-54 | |
| 410129747 | 155 | hypothetical protein [Beta vulgaris] | 0.993 | 0.967 | 0.698 | 1e-53 | |
| 15228313 | 158 | non-symbiotic hemoglobin 2 [Arabidopsis | 0.973 | 0.930 | 0.708 | 1e-53 | |
| 312282137 | 158 | unnamed protein product [Thellungiella h | 0.986 | 0.943 | 0.705 | 5e-53 | |
| 22001640 | 159 | RecName: Full=Non-symbiotic hemoglobin 2 | 0.973 | 0.924 | 0.736 | 7e-53 | |
| 350538955 | 156 | non-symbiotic hemoglobin 2 [Solanum lyco | 1.0 | 0.967 | 0.670 | 9e-52 | |
| 449449389 | 151 | PREDICTED: non-symbiotic hemoglobin 2-li | 0.973 | 0.973 | 0.668 | 2e-50 | |
| 3297847 | 161 | nonsymbiotic hemoglobin [Cichorium intyb | 1.0 | 0.937 | 0.625 | 5e-48 | |
| 7801697 | 165 | hemoglobin [Cichorium intybus x Cichoriu | 0.986 | 0.903 | 0.642 | 8e-48 |
| >gi|297833826|ref|XP_002884795.1| non-symbiotic hemoglobin 2 [Arabidopsis lyrata subsp. lyrata] gi|297330635|gb|EFH61054.1| non-symbiotic hemoglobin 2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 217 bits (553), Expect = 1e-54, Method: Compositional matrix adjust.
Identities = 109/151 (72%), Positives = 124/151 (82%), Gaps = 4/151 (2%)
Query: 3 FTEKQEALVNESWEILKEISHKIACVSSPQI---APAAKGMFSFLRDSDGIPQNNPKLKA 59
FTEKQEALV ESWEILK+ K + QI APAAKG+FSFLRDSD +P NNPKLKA
Sbjct: 6 FTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKGLFSFLRDSDEVPHNNPKLKA 65
Query: 60 HAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEA 119
HAVKVFKMTCE+AIQLREKGKV VADTTL+YLGS+HLK+GV+DPHFEVVKEALLR +KE
Sbjct: 66 HAVKVFKMTCETAIQLREKGKVVVADTTLQYLGSIHLKSGVIDPHFEVVKEALLRTLKEG 125
Query: 120 VGEKWR-DMNCTWVEAYDQLAAAIKAEMKEE 149
+GEK+ D+ W +AYD LA AIK EMK+E
Sbjct: 126 LGEKYNEDVEGGWSQAYDHLALAIKTEMKQE 156
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|22001642|sp|Q941Q2.1|HBL2_BRANA RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=BRAna GLB2; AltName: Full=Hb2 gi|15809392|gb|AAK07741.1| class 2 non-symbiotic hemoglobin [Brassica napus] | Back alignment and taxonomy information |
|---|
| >gi|410129747|dbj|BAM64826.1| hypothetical protein [Beta vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|15228313|ref|NP_187663.1| non-symbiotic hemoglobin 2 [Arabidopsis thaliana] gi|17432971|sp|O24521.1|HBL2_ARATH RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=ARAth GLB2; Short=Hb2 gi|12322784|gb|AAG51381.1|AC011560_13 class 2 non-symbiotic hemoglobin; 69592-70841 [Arabidopsis thaliana] gi|2581785|gb|AAB82770.1| class 2 non-symbiotic hemoglobin [Arabidopsis thaliana] gi|8567781|gb|AAF76353.1| class 2 non-symbiotic hemoglobin [Arabidopsis thaliana] gi|21593239|gb|AAM65188.1| Non-symbiotic hemoglobin Hb2 [Arabidopsis thaliana] gi|114050613|gb|ABI49456.1| At3g10520 [Arabidopsis thaliana] gi|332641398|gb|AEE74919.1| non-symbiotic hemoglobin 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|312282137|dbj|BAJ33934.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|22001640|sp|Q93Y92.1|HBL2_GOSHI RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=GOShi GLB2; Short=Hb2 gi|15809418|gb|AAK21604.1| non-symbiotic hemoglobin class 2 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|350538955|ref|NP_001234111.1| non-symbiotic hemoglobin 2 [Solanum lycopersicum] gi|22001641|sp|Q941P9.1|HBL2_SOLLC RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=Hb2; AltName: Full=SOLly GLB2 gi|15809398|gb|AAK07677.1| non-symbiotic hemoglobin class 2 [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|449449389|ref|XP_004142447.1| PREDICTED: non-symbiotic hemoglobin 2-like [Cucumis sativus] gi|449524778|ref|XP_004169398.1| PREDICTED: non-symbiotic hemoglobin 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|3297847|emb|CAA07547.1| nonsymbiotic hemoglobin [Cichorium intybus x Cichorium endivia] | Back alignment and taxonomy information |
|---|
| >gi|7801697|emb|CAB91629.1| hemoglobin [Cichorium intybus x Cichorium endivia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 151 | ||||||
| TAIR|locus:2075780 | 158 | HB2 "haemoglobin 2" [Arabidops | 0.900 | 0.860 | 0.707 | 3.3e-47 | |
| TAIR|locus:2052981 | 160 | HB1 "hemoglobin 1" [Arabidopsi | 0.907 | 0.856 | 0.566 | 2.2e-34 | |
| ZFIN|ZDB-GENE-011102-1 | 159 | ngb "neuroglobin" [Danio rerio | 0.854 | 0.811 | 0.253 | 4.3e-06 |
| TAIR|locus:2075780 HB2 "haemoglobin 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 494 (179.0 bits), Expect = 3.3e-47, P = 3.3e-47
Identities = 99/140 (70%), Positives = 115/140 (82%)
Query: 3 FTEKQEALVNESWEILKEISHKIACVSSPQI---APAAKGMFSFLRDSDGIPQNNPKLKA 59
FTEKQEALV ESWEILK+ K + QI APAAKG+FSFLRDSD +P NNPKLKA
Sbjct: 6 FTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKGLFSFLRDSDEVPHNNPKLKA 65
Query: 60 HAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEA 119
HAVKVFKMTCE+AIQLRE+GKV VADTTL+YLGS+HLK+GV+DPHFEVVKEALLR +KE
Sbjct: 66 HAVKVFKMTCETAIQLREEGKVVVADTTLQYLGSIHLKSGVIDPHFEVVKEALLRTLKEG 125
Query: 120 VGEKWRD-MNCTWVEAYDQL 138
+GEK+ + + W +AYD L
Sbjct: 126 LGEKYNEEVEGAWSQAYDHL 145
|
|
| TAIR|locus:2052981 HB1 "hemoglobin 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-011102-1 ngb "neuroglobin" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 151 | |||
| cd01040 | 140 | cd01040, globin, Globins are heme proteins, which | 1e-18 | |
| pfam00042 | 108 | pfam00042, Globin, Globin | 1e-11 | |
| PRK13289 | 399 | PRK13289, PRK13289, bifunctional nitric oxide diox | 0.003 |
| >gnl|CDD|238510 cd01040, globin, Globins are heme proteins, which bind and transport oxygen | Back alignment and domain information |
|---|
Score = 76.3 bits (188), Expect = 1e-18
Identities = 37/147 (25%), Positives = 61/147 (41%), Gaps = 15/147 (10%)
Query: 4 TEKQEALVNESWEILKEISHKIACVSSPQI-------APAAKGMFSFLRDSDGIPQNNPK 56
+ +++ LV SW LK +I + P + +FS + +PK
Sbjct: 1 SAEEKKLVKASWAKLKADREEIG----LEFYERLFKAHPETRALFSRFGGLSAALKGSPK 56
Query: 57 LKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAI 116
KAH +V E+ L + + L LG H K GV HF++ EALL +
Sbjct: 57 FKAHGKRVLNALDEAIKNLDDLEAL---KALLAKLGRKHAKRGVDPEHFKLFGEALLEVL 113
Query: 117 KEAVGEKWRD-MNCTWVEAYDQLAAAI 142
E +G+ + + W + D +A A+
Sbjct: 114 AEVLGDDFTPEVKAAWDKLLDVIADAL 140
|
This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue. Length = 140 |
| >gnl|CDD|215673 pfam00042, Globin, Globin | Back alignment and domain information |
|---|
| >gnl|CDD|237337 PRK13289, PRK13289, bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 151 | |||
| cd01040 | 140 | globin Globins are heme proteins, which bind and t | 99.97 | |
| PRK13289 | 399 | bifunctional nitric oxide dioxygenase/dihydropteri | 99.95 | |
| PF00042 | 110 | Globin: Globin plant globin signature erythrocruor | 99.94 | |
| COG1017 | 150 | Hmp Hemoglobin-like flavoprotein [Energy productio | 99.93 | |
| KOG3378 | 385 | consensus Globins and related hemoproteins [Energy | 99.88 | |
| cd01067 | 117 | globin_like superfamily containing globins and tru | 99.75 | |
| cd01068 | 147 | sensor_globin Globin domain present in Globin-Coup | 98.61 | |
| PF11563 | 158 | Protoglobin: Protoglobin; PDB: 2VEE_G 3QZZ_A 3R0G_ | 98.51 | |
| cd00454 | 116 | Trunc_globin Truncated hemoglobins (trHbs) are a f | 98.14 | |
| PF01152 | 120 | Bac_globin: Bacterial-like globin; InterPro: IPR00 | 97.62 | |
| COG2346 | 133 | Truncated hemoglobins [General function prediction | 93.68 |
| >cd01040 globin Globins are heme proteins, which bind and transport oxygen | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.4e-31 Score=185.48 Aligned_cols=136 Identities=27% Similarity=0.451 Sum_probs=127.2
Q ss_pred CHHHHHHHHHHHHHHHhcchhhh---hhhccccCCchhhcCccCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhcccCc
Q 037487 4 TEKQEALVNESWEILKEISHKIA---CVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGK 80 (151)
Q Consensus 4 t~~e~~~i~~SW~~v~~~~~~~~---y~~lF~~~P~~~~~F~~~~~~~~~l~~~~~~~~H~~~v~~~l~~~i~~l~~~~~ 80 (151)
|+.|+++|++||+.+..+...+| |.+||+.+|+++.+|+.++..+.++.+++.|+.|+.+++.+++.+|.++++++.
T Consensus 1 s~~~~~~l~~sw~~~~~~~~~~g~~~f~~lf~~~P~~~~~F~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~v~~l~~~~~ 80 (140)
T cd01040 1 SAEEKKLVKASWAKLKADREEIGLEFYERLFKAHPETRALFSRFGGLSAALKGSPKFKAHGKRVLNALDEAIKNLDDLEA 80 (140)
T ss_pred CHHHHHHHHHHHHHHHccHHhHHHHHHHHHHHHChhHHHHhHHhCCchHhHccCHHHHHHHHHHHHHHHHHHHhccChHH
Confidence 68999999999999998888888 999999999999999998665446789999999999999999999999988777
Q ss_pred hhhHHHHHHHHHHHHhhCCCCCchHhHHHHHHHHHHHHHhcccChh-HHHHHHHHHHHHHHHH
Q 037487 81 VTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRD-MNCTWVEAYDQLAAAI 142 (151)
Q Consensus 81 l~~~~~~l~~Lg~~H~~~gv~~~~f~~~~~~ll~~l~~~lg~~~~~-~~~AW~~~~~~i~~~i 142 (151)
+ ...|++||++|.++|++++||+.|+++|+.++++.+|+.|++ ..+||.+++..|++.|
T Consensus 81 l---~~~l~~lg~~H~~~~v~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~aW~~~~~~i~~~~ 140 (140)
T cd01040 81 L---KALLAKLGRKHAKRGVDPEHFKLFGEALLEVLAEVLGDDFTPEVKAAWDKLLDVIADAL 140 (140)
T ss_pred H---HHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHhCCcCCHHHHHHHHHHHHHHHHhC
Confidence 6 888999999999999999999999999999999999999999 9999999999998764
|
This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue. |
| >PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional | Back alignment and domain information |
|---|
| >PF00042 Globin: Globin plant globin signature erythrocruorin family signature alpha hemoglobin signature myoglobin signature thalassemia | Back alignment and domain information |
|---|
| >COG1017 Hmp Hemoglobin-like flavoprotein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01067 globin_like superfamily containing globins and truncated hemoglobins | Back alignment and domain information |
|---|
| >cd01068 sensor_globin Globin domain present in Globin-Coupled-Sensors (GCS) | Back alignment and domain information |
|---|
| >PF11563 Protoglobin: Protoglobin; PDB: 2VEE_G 3QZZ_A 3R0G_A 3QZX_A 2VEB_A 1OR6_A 1OR4_B 2W31_B | Back alignment and domain information |
|---|
| >cd00454 Trunc_globin Truncated hemoglobins (trHbs) are a family of oxygen-binding heme proteins found in cyanobacteria, eubacteria, unicellular eukaryotes, and plants | Back alignment and domain information |
|---|
| >PF01152 Bac_globin: Bacterial-like globin; InterPro: IPR001486 Globins are haem-containing proteins involved in binding and/or transporting oxygen | Back alignment and domain information |
|---|
| >COG2346 Truncated hemoglobins [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 151 | ||||
| 3qqq_A | 168 | Crystal Structure Of Non-Symbiotic Plant Hemoglobin | 8e-37 | ||
| 2gnv_A | 165 | Crystal Structure Of Non-Symbiotic Plant Hemoglobin | 7e-36 | ||
| 1d8u_A | 166 | Crystal Structure Of Non-Symbiotic Plant Hemoglobin | 8e-36 | ||
| 2gnw_A | 165 | Crystal Structure Of Non-Symbiotic Plant Hemoglobin | 1e-35 | ||
| 2oif_A | 162 | The Crystal Structure Of Ferric Cyanide Bound Barle | 5e-35 | ||
| 2r50_A | 165 | The Crystal Structure Of Nonsymbiotic Corn Hemoglob | 1e-34 | ||
| 3qqr_A | 162 | Crystal Structure Of Parasponia Hemoglobin; Differe | 2e-34 | ||
| 1gdi_A | 153 | Crystal Structure Of Ferric Complexes Of The Yellow | 6e-33 | ||
| 1fsl_A | 143 | Ferric Soybean Leghemoglobin Complexed With Nicotin | 3e-26 |
| >pdb|3QQQ|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Trema Tomentosa Length = 168 | Back alignment and structure |
|
| >pdb|2GNV|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Rice, B10 Mutant F40l Length = 165 | Back alignment and structure |
| >pdb|1D8U|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Rice Length = 166 | Back alignment and structure |
| >pdb|2GNW|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Rice, B10 Mutant F40w Length = 165 | Back alignment and structure |
| >pdb|2OIF|A Chain A, The Crystal Structure Of Ferric Cyanide Bound Barley Hexacoordinate Hemoglobin. Length = 162 | Back alignment and structure |
| >pdb|2R50|A Chain A, The Crystal Structure Of Nonsymbiotic Corn Hemoglobin 1 Length = 165 | Back alignment and structure |
| >pdb|3QQR|A Chain A, Crystal Structure Of Parasponia Hemoglobin; Differential Heme Coordination Is Linked To Quaternary Structure Length = 162 | Back alignment and structure |
| >pdb|1GDI|A Chain A, Crystal Structure Of Ferric Complexes Of The Yellow Lupin Leghemoglobin With Isoquinoline At 1.8 Angstroms Resolution (Russian) Length = 153 | Back alignment and structure |
| >pdb|1FSL|A Chain A, Ferric Soybean Leghemoglobin Complexed With Nicotinate Length = 143 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 151 | |||
| 2oif_A | 162 | Horvu GLB1, non-legume hemoglobin; hexacoordinate | 2e-37 | |
| 1gdj_A | 153 | Leghemoglobin (deoxy); oxygen transport; HET: HEM; | 8e-36 | |
| 1bin_A | 143 | Leghemoglobin A; heme, nitrogen fixation, multigen | 3e-31 | |
| 1q1f_A | 151 | Neuroglobin; globin fold, heme protein, oxygen sto | 2e-30 | |
| 1sct_A | 150 | Hemoglobin II (carbonmonoxy) (alpha chain); oxygen | 9e-30 | |
| 1hlb_A | 158 | Hemoglobin (deoxy); oxygen transport; HET: HEM; 2. | 1e-28 | |
| 2c0k_A | 151 | Hemoglobin; oxygen transport, heme, iron, metal-bi | 3e-28 | |
| 1x46_A | 150 | Globin chain, hemoglobin component VII; diptera, m | 2e-27 | |
| 2zs0_A | 140 | Extracellular giant hemoglobin major globin subun; | 6e-27 | |
| 1sct_B | 151 | Hemoglobin II (carbonmonoxy) (beta chain); oxygen | 1e-26 | |
| 1eca_A | 136 | Erythrocruorin (AQUO Met); oxygen transport; HET: | 3e-26 | |
| 1b0b_A | 142 | Hemoglobin; hemoprotein, sulfide carrier, globins, | 4e-26 | |
| 2dc3_A | 193 | Cytoglobin; myoglobin, heme, oxygen transport, oxy | 5e-26 | |
| 1jf3_A | 147 | Monomer hemoglobin component III; oxygen storage/t | 7e-26 | |
| 1hlm_A | 159 | Hemoglobin (cyano Met); oxygen transport; HET: HEM | 9e-26 | |
| 3pt8_B | 152 | Hemoglobin III; oxygen carrier, oxygen transport; | 3e-25 | |
| 1x9f_B | 145 | Erythrocruorin, globin II, extracellular, globin A | 5e-25 | |
| 3ubc_A | 131 | Hemoglobin-like flavoprotein; oxygen-bound, autoxi | 6e-25 | |
| 3pt8_A | 152 | Hemoglobin II; oxygen carrier, oxygen transport; H | 1e-24 | |
| 2bk9_A | 153 | CG9734-PA; oxygen transport, drosophila melanogast | 2e-24 | |
| 1yhu_B | 144 | Giant hemoglobins B chain; globin fold, oxygen sto | 2e-24 | |
| 1mba_A | 147 | Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysi | 2e-24 | |
| 1x9f_D | 140 | Globin C, hemoglobin chain D1, globin III, extrace | 2e-24 | |
| 2zs0_B | 142 | Extracellular giant hemoglobin major globin subun; | 4e-24 | |
| 1yhu_A | 145 | Hemoglobin A1 chain; globin fold, oxygen storage-t | 1e-23 | |
| 1ith_A | 141 | Hemoglobin (cyano Met); oxygen transport; HET: HEM | 2e-23 | |
| 3g46_A | 146 | Globin-1; oxygen transport, allostery, oxygen affi | 3e-22 | |
| 1x9f_C | 153 | Erythrocruorin, globin III, extracellular, globin | 4e-22 | |
| 2zs0_C | 147 | Extracellular giant hemoglobin major globin subun; | 1e-21 | |
| 2vhb_A | 146 | Hemoglobin; heme, respiratory protein, oxygen tran | 2e-21 | |
| 1yhu_D | 149 | Hemoglobin B2 chain; globin fold, oxygen storage-t | 9e-21 | |
| 1yhu_C | 148 | Hemoglobin B1A chain; globin fold, oxygen storage- | 1e-20 | |
| 1x3k_A | 152 | Hemoglobin component V; diptera, midge larva, oxyg | 2e-20 | |
| 2zs0_D | 145 | Extracellular giant hemoglobin major globin subun; | 1e-19 | |
| 2wy4_A | 140 | Single domain haemoglobin; heme, transport, oxygen | 4e-19 | |
| 1x9f_A | 151 | Globin IV, extracellular; crystal, dodecamer, allo | 4e-19 | |
| 1out_B | 146 | Hemoglobin I; heme, oxygen transport, respiratory | 6e-19 | |
| 1it2_A | 146 | Hemoglobin; hagfish, deoxy form, oxygen storage/tr | 1e-18 | |
| 2w72_B | 146 | Human hemoglobin A; iron, heme, glycation, transpo | 1e-18 | |
| 2lhb_A | 149 | Hemoglobin V (cyano Met); oxygen transport; HET: H | 2e-18 | |
| 3d1k_A | 142 | Hemoglobin subunit alpha-1; antarctic FISH hemoglo | 4e-18 | |
| 2aa1_B | 146 | Hemoglobin beta-C chain; ROOT effect, cooperativit | 5e-18 | |
| 1lhs_A | 153 | Myoglobin; oxygen storage; HET: HEM; 2.00A {Carett | 1e-17 | |
| 1cg5_B | 141 | Protein (hemoglobin); oxygen transport; HET: HEM; | 1e-17 | |
| 1a6m_A | 151 | Myoglobin; heme protein, model compounds, oxygen s | 2e-17 | |
| 1spg_A | 144 | Hemoglobin; carbon monoxide, R-state, teleost FISH | 8e-17 | |
| 1jeb_A | 142 | Hemoglobin zeta chain; oxygen transport, oxygen st | 1e-16 | |
| 3d1k_B | 146 | Hemoglobin subunit beta-1/2; antarctic FISH hemogl | 2e-16 | |
| 2w72_C | 141 | Human hemoglobin A; iron, heme, glycation, transpo | 6e-16 | |
| 1xq5_A | 143 | Hemoglobin alpha-1 chain; FISH hemoglobin, rapid o | 2e-15 | |
| 1cg5_A | 141 | Protein (hemoglobin); oxygen transport; HET: HEM; | 2e-15 | |
| 1wmu_A | 141 | Hemoglobin D alpha chain; hemoglobin D, reptilia, | 3e-15 | |
| 1out_A | 143 | Hemoglobin I; heme, oxygen transport, respiratory | 7e-15 | |
| 2nrl_A | 147 | Myoglobin; transport protein; HET: HEM; 0.91A {Thu | 2e-14 | |
| 1v4x_B | 146 | Hemoglobin beta chain; oxygen transport, heme, res | 4e-14 | |
| 2r80_B | 146 | Hemoglobin subunit beta; oxygen tranport/storage, | 1e-13 | |
| 3bom_A | 143 | Hemoglobin subunit alpha-4; FISH hemoglobin, struc | 5e-13 | |
| 3bom_B | 147 | Hemoglobin subunit beta-4; FISH hemoglobin, struct | 1e-12 | |
| 1c7c_A | 283 | Protein (deoxyhemoglobin (alpha chain)); heme, oxy | 2e-11 | |
| 1c7c_A | 283 | Protein (deoxyhemoglobin (alpha chain)); heme, oxy | 7e-11 | |
| 3mkb_A | 140 | Hemoglobin subunit alpha; oxygen affinity, shortfi | 3e-10 | |
| 1tu9_A | 134 | Hypothetical protein PA3967; structural genomics, | 6e-10 | |
| 3mvc_A | 161 | Globin protein 6; oxygen sensor, heme-binding prot | 3e-09 | |
| 1h97_A | 147 | Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitu | 4e-09 | |
| 2r80_A | 141 | Hemoglobin subunit alpha-A; oxygen tranport/storag | 4e-09 | |
| 2vyw_A | 148 | Hemoglobin; trematode, oxygen binding; HET: HEM; 1 | 4e-07 | |
| 1gvh_A | 396 | Flavohemoprotein; oxidoreductase, NADP, heme, flav | 5e-06 | |
| 3lb2_A | 137 | Dehaloperoxidase A; globin, oxidoreductase; HET: H | 1e-05 | |
| 1cqx_A | 403 | Flavohemoprotein; globin fold, six-stranded antipa | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-05 | |
| 3mkb_B | 136 | Hemoglobin subunit beta; oxygen affinity, shortfin | 4e-04 |
| >2oif_A Horvu GLB1, non-legume hemoglobin; hexacoordinate hemoglobin, barley, ligand binding, non- symbiotic, symbiotic, evolution; HET: HEM; 1.80A {Hordeum vulgare} PDB: 2r50_A* 1d8u_A* 2gnv_A* 2gnw_A* 3qqq_A* 3qqr_A* Length = 162 | Back alignment and structure |
|---|
Score = 124 bits (313), Expect = 2e-37
Identities = 85/153 (55%), Positives = 105/153 (68%), Gaps = 5/153 (3%)
Query: 1 MVFTEKQEALVNESWEILKEISHKIACVSSPQI---APAAKGMFSFLRDSDGIPQNNPKL 57
+VF+E++EALV +SW I+K+ S + +I AP+A+ MF FLRDSD + NPKL
Sbjct: 8 VVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSDVPLETNPKL 67
Query: 58 KAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIK 117
K HAV VF MTCE+A QLR+ GK+TV +TTLK LG HLK GV D HFEV + ALL IK
Sbjct: 68 KTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHFEVTRFALLETIK 127
Query: 118 EAV-GEKW-RDMNCTWVEAYDQLAAAIKAEMKE 148
EA+ + W +M W EAYDQL AAIK EMK
Sbjct: 128 EALPADMWGPEMRNAWGEAYDQLVAAIKQEMKP 160
|
| >1gdj_A Leghemoglobin (deoxy); oxygen transport; HET: HEM; 1.70A {Lupinus luteus} SCOP: a.1.1.2 PDB: 1gdi_A* 1gdk_A* 1gdl_A* 1lh1_A* 1lh2_A* 1lh3_A* 1lh5_A* 1lh6_A* 1lh7_A* 2gdm_A* 2lh1_A* 2lh2_A* 2lh3_A* 2lh5_A* 2lh6_A* 2lh7_A* Length = 153 | Back alignment and structure |
|---|
| >1bin_A Leghemoglobin A; heme, nitrogen fixation, multigene family, oxygen transport; HET: HEM; 2.20A {Glycine max} SCOP: a.1.1.2 PDB: 1fsl_A* Length = 143 | Back alignment and structure |
|---|
| >1q1f_A Neuroglobin; globin fold, heme protein, oxygen storage/transport complex; HET: HEM; 1.50A {Mus musculus} SCOP: a.1.1.2 PDB: 1w92_A* 3gk9_A* 2vry_A* 3gkt_A* 3gln_A* 1oj6_A* Length = 151 | Back alignment and structure |
|---|
| >1sct_A Hemoglobin II (carbonmonoxy) (alpha chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Length = 150 | Back alignment and structure |
|---|
| >1hlb_A Hemoglobin (deoxy); oxygen transport; HET: HEM; 2.50A {Caudina arenicola} SCOP: a.1.1.2 Length = 158 | Back alignment and structure |
|---|
| >2c0k_A Hemoglobin; oxygen transport, heme, iron, metal-binding; HET: HEM; 2.6A {Gasterophilus intestinalis} Length = 151 | Back alignment and structure |
|---|
| >1x46_A Globin chain, hemoglobin component VII; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.50A {Tokunagayusurika akamusi} Length = 150 | Back alignment and structure |
|---|
| >2zs0_A Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_A* 2d2m_A* 2zfo_A* 2zs1_A* Length = 140 | Back alignment and structure |
|---|
| >1sct_B Hemoglobin II (carbonmonoxy) (beta chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Length = 151 | Back alignment and structure |
|---|
| >1eca_A Erythrocruorin (AQUO Met); oxygen transport; HET: HEM; 1.40A {Chironomus thummi thummi} SCOP: a.1.1.2 PDB: 1ecd_A* 1ecn_A* 1eco_A* Length = 136 | Back alignment and structure |
|---|
| >1b0b_A Hemoglobin; hemoprotein, sulfide carrier, globins, oxygen transport, oxygen storage/transport complex; HET: HEM; 1.43A {Lucina pectinata} SCOP: a.1.1.2 PDB: 1ebt_A* 1flp_A* 1moh_A* Length = 142 | Back alignment and structure |
|---|
| >2dc3_A Cytoglobin; myoglobin, heme, oxygen transport, oxygen storage, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.68A {Homo sapiens} PDB: 1v5h_A* 3ag0_A* 1urv_A* 1umo_A* 1ury_A* 1ut0_A* 1ux9_A* Length = 193 | Back alignment and structure |
|---|
| >1jf3_A Monomer hemoglobin component III; oxygen storage/transport complex; HET: HEM; 1.40A {Glycera dibranchiata} SCOP: a.1.1.2 PDB: 1jl7_A* 1jf4_A* 1jl6_A* 1vre_A* 1vrf_A* 1hbg_A* 2hbg_A* Length = 147 | Back alignment and structure |
|---|
| >1hlm_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.90A {Caudina arenicola} SCOP: a.1.1.2 Length = 159 | Back alignment and structure |
|---|
| >3pt8_B Hemoglobin III; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} PDB: 3pt7_B* Length = 152 | Back alignment and structure |
|---|
| >1x9f_B Erythrocruorin, globin II, extracellular, globin AIII, globin B; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_B* Length = 145 | Back alignment and structure |
|---|
| >3ubc_A Hemoglobin-like flavoprotein; oxygen-bound, autoxidation, nanotemplate, langmuir-blodgett, films, oxygen transport; HET: HEM; 1.65A {Methylacidiphilum infernorum V4} PDB: 3ubv_A* 3s1i_A* 3s1j_A* Length = 131 | Back alignment and structure |
|---|
| >3pt8_A Hemoglobin II; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} PDB: 3pi1_A* 2olp_A* 3pi3_A* 3pi4_A* 3pt7_A* 3pi2_A* Length = 152 | Back alignment and structure |
|---|
| >2bk9_A CG9734-PA; oxygen transport, drosophila melanogaster hemoglobin, heme hexacoordination, insect hemoglobin, protein cavities; HET: HEM CXS; 1.2A {Drosophila melanogaster} PDB: 2g3h_A* Length = 153 | Back alignment and structure |
|---|
| >1yhu_B Giant hemoglobins B chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 144 | Back alignment and structure |
|---|
| >1mba_A Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysia limacina} SCOP: a.1.1.2 PDB: 2fal_A* 3mba_A* 4mba_A* 5mba_A* 2fam_A* 1dm1_A* Length = 147 | Back alignment and structure |
|---|
| >1x9f_D Globin C, hemoglobin chain D1, globin III, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_D* Length = 140 | Back alignment and structure |
|---|
| >2zs0_B Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_B* 2d2m_B* 2zfo_B* 2zs1_B* Length = 142 | Back alignment and structure |
|---|
| >1yhu_A Hemoglobin A1 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 145 | Back alignment and structure |
|---|
| >1ith_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.50A {Urechis caupo} SCOP: a.1.1.2 Length = 141 | Back alignment and structure |
|---|
| >3g46_A Globin-1; oxygen transport, allostery, oxygen affinity, cytoplasm, heme, iron, metal-binding, oxygen storage/transport, oxygen binding; HET: HEM; 0.91A {Scapharca inaequivalvis} PDB: 1nxf_A* 3g4q_A* 3g4r_A* 3g4u_A* 3g4v_A* 3g4w_A* 3g4y_A* 3g52_A* 3g53_A* 3uhg_A* 3uhs_A* 3uhk_A* 3uhi_A* 3uhn_A* 3ugy_A* 2auo_A* 2aup_A* 3uhr_A* 3uh5_A* 3uh3_A* ... Length = 146 | Back alignment and structure |
|---|
| >1x9f_C Erythrocruorin, globin III, extracellular, globin C; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_C* Length = 153 | Back alignment and structure |
|---|
| >2zs0_C Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_C* 2d2m_C* 2zfo_C* 2zs1_C* Length = 147 | Back alignment and structure |
|---|
| >2vhb_A Hemoglobin; heme, respiratory protein, oxygen transport; HET: HEM; 1.76A {Vitreoscilla stercoraria} SCOP: a.1.1.2 PDB: 1vhb_A* 3vhb_A* 4vhb_A* Length = 146 | Back alignment and structure |
|---|
| >1yhu_D Hemoglobin B2 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 149 | Back alignment and structure |
|---|
| >1yhu_C Hemoglobin B1A chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 148 | Back alignment and structure |
|---|
| >1x3k_A Hemoglobin component V; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.64A {Tokunagayusurika akamusi} PDB: 2zwj_A* 3a5a_A* 3a5b_A* 3a5g_A* 3a9m_A* 3arj_A* 3ark_A* 3arl_A* Length = 152 | Back alignment and structure |
|---|
| >2zs0_D Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2zfo_D* 2zs1_D* 2d2m_D* 2d2n_D* Length = 145 | Back alignment and structure |
|---|
| >2wy4_A Single domain haemoglobin; heme, transport, oxygen transport; HET: HEM; 1.35A {Campylobacter jejuni} Length = 140 | Back alignment and structure |
|---|
| >1x9f_A Globin IV, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_A* Length = 151 | Back alignment and structure |
|---|
| >1out_B Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_B* Length = 146 | Back alignment and structure |
|---|
| >1it2_A Hemoglobin; hagfish, deoxy form, oxygen storage/transport complex; HET: HEM; 1.60A {Eptatretus burgeri} SCOP: a.1.1.2 PDB: 1it3_A* Length = 146 | Back alignment and structure |
|---|
| >2w72_B Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7w_B* 1qi8_B* 1j7y_B* 1dxu_B* 1a0u_B* 1a0z_B* 1gli_B* 1j7s_B* 1o1l_B* 1o1n_B* 1y0t_B* 1y0w_B* 1o1o_B* 1ye2_B* 1y35_B* 1y22_B* 1ye0_B* 1dxt_B* 1y5f_B* 1ird_B* ... Length = 146 | Back alignment and structure |
|---|
| >2lhb_A Hemoglobin V (cyano Met); oxygen transport; HET: HEM; 2.00A {Petromyzon marinus} SCOP: a.1.1.2 PDB: 3lhb_A* 1f5o_A* 1f5p_A* 1uc3_A* Length = 149 | Back alignment and structure |
|---|
| >3d1k_A Hemoglobin subunit alpha-1; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 2aa1_A* 1t1n_A* 1la6_A* 3nfe_A* 3ng6_A* 2h8f_A* 1pbx_A* 1s5x_A* 1s5y_A* 1hbh_A* 2h8d_A* 2peg_A* 3gkv_A* 3gqg_A* 1v4x_A* 1v4u_A* 1v4w_A* Length = 142 | Back alignment and structure |
|---|
| >2aa1_B Hemoglobin beta-C chain; ROOT effect, cooperativity, antarctic FISH, oxygen storage/transport complex; HET: HEM; 1.80A {Trematomus newnesi} SCOP: a.1.1.2 PDB: 1xq5_B* 3bj1_B* 3bj2_B* 3bj3_B* Length = 146 | Back alignment and structure |
|---|
| >1lhs_A Myoglobin; oxygen storage; HET: HEM; 2.00A {Caretta caretta} SCOP: a.1.1.2 PDB: 1lht_A* Length = 153 | Back alignment and structure |
|---|
| >1cg5_B Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_B* Length = 141 | Back alignment and structure |
|---|
| >1a6m_A Myoglobin; heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates, oxygen transpor; HET: HEM; 1.00A {Physeter catodon} SCOP: a.1.1.2 PDB: 1a6k_A* 1a6n_A* 2jho_A* 1ufp_A* 2eb9_A* 2eb8_A* 2w6w_A* 2ekt_A* 105m_A* 104m_A* 1ajh_A* 1ajg_A* 1bvc_A* 1bvd_A* 1bz6_A* 1bzr_A* 1cq2_A* 1duk_A* 1ebc_A* 1hjt_A* ... Length = 151 | Back alignment and structure |
|---|
| >1spg_A Hemoglobin; carbon monoxide, R-state, teleost FISH effect, oxygen transport; HET: HEM; 1.95A {Leiostomus xanthurus} SCOP: a.1.1.2 Length = 144 | Back alignment and structure |
|---|
| >1jeb_A Hemoglobin zeta chain; oxygen transport, oxygen storage/transport complex; HET: HEM; 2.10A {Homo sapiens} SCOP: a.1.1.2 Length = 142 | Back alignment and structure |
|---|
| >3d1k_B Hemoglobin subunit beta-1/2; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 1t1n_B* 1la6_B* 3nfe_B* 3ng6_B* 2h8f_B* 1pbx_B* 1s5x_B* 1s5y_B* 1hbh_B* 2h8d_B* 2peg_B* 3gkv_B* 3gqg_B* Length = 146 | Back alignment and structure |
|---|
| >2w72_C Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7s_A* 1qi8_A* 1j7y_A* 1o1i_A* 2w72_A* 1bzz_A* 1c7b_A* 1j7w_A* 1o1k_A* 1o1o_A* 1y0c_A* 1ydz_A* 3ia3_B* 1ird_A* 1a00_A* 1a0u_A* 1a0z_A* 1a3n_A* 1a9w_A* 1b86_A* ... Length = 141 | Back alignment and structure |
|---|
| >1xq5_A Hemoglobin alpha-1 chain; FISH hemoglobin, rapid oxidation, structural genomics, protein structure initiative, PSI, CESG; HET: HEM; 1.90A {Perca flavescens} SCOP: a.1.1.2 PDB: 3bj1_A* 3bj2_A* 3bj3_A* 3bcq_A* Length = 143 | Back alignment and structure |
|---|
| >1cg5_A Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_A* Length = 141 | Back alignment and structure |
|---|
| >1wmu_A Hemoglobin D alpha chain; hemoglobin D, reptilia, the aldabra giant tortoise, geochelone gigantea, oxygen storage/transport complex; HET: HEM; 1.65A {Dipsochelys dussumieri} SCOP: a.1.1.2 PDB: 1v75_A* 2z6n_A* 1hbr_A* Length = 141 | Back alignment and structure |
|---|
| >1out_A Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_A* Length = 143 | Back alignment and structure |
|---|
| >2nrl_A Myoglobin; transport protein; HET: HEM; 0.91A {Thunnus atlanticus} PDB: 2nx0_A* 3qm5_A* 3qm6_A* 3qm7_A* 3qm8_A* 3qm9_A* 3qma_A* 1myt_A* 2nrm_A* Length = 147 | Back alignment and structure |
|---|
| >1v4x_B Hemoglobin beta chain; oxygen transport, heme, respiratory protein, erythrocyte, ROOT effect, SWIM bladder, oxygen storage/transport complex; HET: HEM; 1.60A {Thunnus thynnus} SCOP: a.1.1.2 PDB: 1v4u_B* 1v4w_B* Length = 146 | Back alignment and structure |
|---|
| >2r80_B Hemoglobin subunit beta; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3dhr_B* 3mju_B* 1faw_B* 3k8b_B* 2qmb_B* 3eok_B* 1a4f_B* 1c40_B* 1hv4_B* 2zfb_B* 3mjp_B* 1hbr_B* 3fs4_B* 3a59_B* 1wmu_B* 1v75_B* 2z6n_B* 3at5_B* 3at6_B* Length = 146 | Back alignment and structure |
|---|
| >3bom_A Hemoglobin subunit alpha-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_A* Length = 143 | Back alignment and structure |
|---|
| >3bom_B Hemoglobin subunit beta-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_B* 3bcq_B* 1spg_B* Length = 147 | Back alignment and structure |
|---|
| >1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Length = 283 | Back alignment and structure |
|---|
| >1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Length = 283 | Back alignment and structure |
|---|
| >3mkb_A Hemoglobin subunit alpha; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} PDB: 1gcv_A* 1gcw_A* Length = 140 | Back alignment and structure |
|---|
| >1tu9_A Hypothetical protein PA3967; structural genomics, heme, hemoglobin, pseudomonas aeruginos PSI, protein structure initiative; HET: HEM; 1.20A {Pseudomonas aeruginosa} SCOP: a.1.1.2 Length = 134 | Back alignment and structure |
|---|
| >3mvc_A Globin protein 6; oxygen sensor, heme-binding protein, C. elegans, OXY transport, electron transport; HET: HEM; 1.40A {Caenorhabditis elegans} Length = 161 | Back alignment and structure |
|---|
| >1h97_A Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitum} SCOP: a.1.1.2 PDB: 1kfr_A* Length = 147 | Back alignment and structure |
|---|
| >2r80_A Hemoglobin subunit alpha-A; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3mju_A* 3dhr_A* 3mjp_A* 1faw_A* 3eok_A* 3k8b_A* 2qmb_A* 3fs4_A* 3a59_A* 1a4f_A* 1hv4_A* 2zfb_A* 1c40_A* 3at5_A* 3at6_A* Length = 141 | Back alignment and structure |
|---|
| >2vyw_A Hemoglobin; trematode, oxygen binding; HET: HEM; 1.8A {Fasciola hepatica} Length = 148 | Back alignment and structure |
|---|
| >1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396 | Back alignment and structure |
|---|
| >3lb2_A Dehaloperoxidase A; globin, oxidoreductase; HET: HEM; 1.06A {Amphitrite ornata} PDB: 1ewa_A* 1ew6_A* 2qfk_A* 3kun_A* 3lb1_A* 3dr9_A* 3lb3_A* 3lb4_A* 3mou_A* 3ord_A* 3mym_A* 3k3u_A* 3o7n_A* 3kuo_A* 2qfn_A* 3myn_A* 3oj1_A* 3ok5_A* 3ixf_A* Length = 137 | Back alignment and structure |
|---|
| >1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Length = 403 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3mkb_B Hemoglobin subunit beta; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} Length = 136 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 151 | |||
| 1out_A | 143 | Hemoglobin I; heme, oxygen transport, respiratory | 100.0 | |
| 4b4y_A | 154 | Neuroglobin; transport protein, nervous system evo | 100.0 | |
| 1gdj_A | 153 | Leghemoglobin (deoxy); oxygen transport; HET: HEM; | 100.0 | |
| 3bom_A | 143 | Hemoglobin subunit alpha-4; FISH hemoglobin, struc | 100.0 | |
| 1xq5_A | 143 | Hemoglobin alpha-1 chain; FISH hemoglobin, rapid o | 100.0 | |
| 1spg_A | 144 | Hemoglobin; carbon monoxide, R-state, teleost FISH | 100.0 | |
| 2c0k_A | 151 | Hemoglobin; oxygen transport, heme, iron, metal-bi | 100.0 | |
| 3d1k_A | 142 | Hemoglobin subunit alpha-1; antarctic FISH hemoglo | 100.0 | |
| 1cg5_B | 141 | Protein (hemoglobin); oxygen transport; HET: HEM; | 100.0 | |
| 1jeb_A | 142 | Hemoglobin zeta chain; oxygen transport, oxygen st | 100.0 | |
| 2dc3_A | 193 | Cytoglobin; myoglobin, heme, oxygen transport, oxy | 100.0 | |
| 2bk9_A | 153 | CG9734-PA; oxygen transport, drosophila melanogast | 100.0 | |
| 1x46_A | 150 | Globin chain, hemoglobin component VII; diptera, m | 100.0 | |
| 3pt8_B | 152 | Hemoglobin III; oxygen carrier, oxygen transport; | 100.0 | |
| 1cg5_A | 141 | Protein (hemoglobin); oxygen transport; HET: HEM; | 100.0 | |
| 3d1k_B | 146 | Hemoglobin subunit beta-1/2; antarctic FISH hemogl | 100.0 | |
| 2r80_A | 141 | Hemoglobin subunit alpha-A; oxygen tranport/storag | 100.0 | |
| 1a6m_A | 151 | Myoglobin; heme protein, model compounds, oxygen s | 100.0 | |
| 3pt8_A | 152 | Hemoglobin II; oxygen carrier, oxygen transport; H | 100.0 | |
| 1hlb_A | 158 | Hemoglobin (deoxy); oxygen transport; HET: HEM; 2. | 100.0 | |
| 4hrt_A | 150 | Globin-2 A chain; oxygen transport, globin fold, o | 100.0 | |
| 1wmu_A | 141 | Hemoglobin D alpha chain; hemoglobin D, reptilia, | 100.0 | |
| 2aa1_B | 146 | Hemoglobin beta-C chain; ROOT effect, cooperativit | 100.0 | |
| 2oif_A | 162 | Horvu GLB1, non-legume hemoglobin; hexacoordinate | 100.0 | |
| 1lhs_A | 153 | Myoglobin; oxygen storage; HET: HEM; 2.00A {Carett | 100.0 | |
| 1v4x_B | 146 | Hemoglobin beta chain; oxygen transport, heme, res | 100.0 | |
| 2r80_B | 146 | Hemoglobin subunit beta; oxygen tranport/storage, | 100.0 | |
| 2w72_B | 146 | Human hemoglobin A; iron, heme, glycation, transpo | 100.0 | |
| 4hrt_B | 152 | Hemoglobin B chain; oxygen transport, globin fold, | 100.0 | |
| 1q1f_A | 151 | Neuroglobin; globin fold, heme protein, oxygen sto | 100.0 | |
| 3mkb_A | 140 | Hemoglobin subunit alpha; oxygen affinity, shortfi | 100.0 | |
| 3bom_B | 147 | Hemoglobin subunit beta-4; FISH hemoglobin, struct | 100.0 | |
| 1hlm_A | 159 | Hemoglobin (cyano Met); oxygen transport; HET: HEM | 100.0 | |
| 1sct_A | 150 | Hemoglobin II (carbonmonoxy) (alpha chain); oxygen | 100.0 | |
| 2w72_C | 141 | Human hemoglobin A; iron, heme, glycation, transpo | 100.0 | |
| 1mba_A | 147 | Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysi | 100.0 | |
| 1sct_B | 151 | Hemoglobin II (carbonmonoxy) (beta chain); oxygen | 100.0 | |
| 1yhu_A | 145 | Hemoglobin A1 chain; globin fold, oxygen storage-t | 100.0 | |
| 1jf3_A | 147 | Monomer hemoglobin component III; oxygen storage/t | 100.0 | |
| 1out_B | 146 | Hemoglobin I; heme, oxygen transport, respiratory | 100.0 | |
| 1x9f_B | 145 | Erythrocruorin, globin II, extracellular, globin A | 100.0 | |
| 1x3k_A | 152 | Hemoglobin component V; diptera, midge larva, oxyg | 100.0 | |
| 1ith_A | 141 | Hemoglobin (cyano Met); oxygen transport; HET: HEM | 100.0 | |
| 1x9f_D | 140 | Globin C, hemoglobin chain D1, globin III, extrace | 100.0 | |
| 1x9f_C | 153 | Erythrocruorin, globin III, extracellular, globin | 100.0 | |
| 1bin_A | 143 | Leghemoglobin A; heme, nitrogen fixation, multigen | 100.0 | |
| 3mkb_B | 136 | Hemoglobin subunit beta; oxygen affinity, shortfin | 100.0 | |
| 1yhu_D | 149 | Hemoglobin B2 chain; globin fold, oxygen storage-t | 100.0 | |
| 1gcv_B | 136 | Hemoglobin; oxygen storage/transport complex; HET: | 100.0 | |
| 2zs0_B | 142 | Extracellular giant hemoglobin major globin subun; | 100.0 | |
| 1x9f_A | 151 | Globin IV, extracellular; crystal, dodecamer, allo | 100.0 | |
| 2zs0_A | 140 | Extracellular giant hemoglobin major globin subun; | 100.0 | |
| 1yhu_C | 148 | Hemoglobin B1A chain; globin fold, oxygen storage- | 100.0 | |
| 3g46_A | 146 | Globin-1; oxygen transport, allostery, oxygen affi | 100.0 | |
| 1b0b_A | 142 | Hemoglobin; hemoprotein, sulfide carrier, globins, | 100.0 | |
| 3ubc_A | 131 | Hemoglobin-like flavoprotein; oxygen-bound, autoxi | 100.0 | |
| 2zs0_C | 147 | Extracellular giant hemoglobin major globin subun; | 100.0 | |
| 3mvc_A | 161 | Globin protein 6; oxygen sensor, heme-binding prot | 100.0 | |
| 1yhu_B | 144 | Giant hemoglobins B chain; globin fold, oxygen sto | 100.0 | |
| 1it2_A | 146 | Hemoglobin; hagfish, deoxy form, oxygen storage/tr | 100.0 | |
| 2lhb_A | 149 | Hemoglobin V (cyano Met); oxygen transport; HET: H | 100.0 | |
| 2zs0_D | 145 | Extracellular giant hemoglobin major globin subun; | 100.0 | |
| 2nrl_A | 147 | Myoglobin; transport protein; HET: HEM; 0.91A {Thu | 100.0 | |
| 1c7c_A | 283 | Protein (deoxyhemoglobin (alpha chain)); heme, oxy | 100.0 | |
| 1eca_A | 136 | Erythrocruorin (AQUO Met); oxygen transport; HET: | 100.0 | |
| 1h97_A | 147 | Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitu | 100.0 | |
| 2wtg_A | 159 | Globin-like protein; metal-binding, oxygen transpo | 100.0 | |
| 1c7c_A | 283 | Protein (deoxyhemoglobin (alpha chain)); heme, oxy | 100.0 | |
| 2vyw_A | 148 | Hemoglobin; trematode, oxygen binding; HET: HEM; 1 | 100.0 | |
| 2vhb_A | 146 | Hemoglobin; heme, respiratory protein, oxygen tran | 100.0 | |
| 3lb2_A | 137 | Dehaloperoxidase A; globin, oxidoreductase; HET: H | 99.97 | |
| 2wy4_A | 140 | Single domain haemoglobin; heme, transport, oxygen | 99.97 | |
| 1tu9_A | 134 | Hypothetical protein PA3967; structural genomics, | 99.97 | |
| 1cqx_A | 403 | Flavohemoprotein; globin fold, six-stranded antipa | 99.95 | |
| 4g1v_A | 399 | Flavohemoglobin; three domains: globin fold, antip | 99.95 | |
| 1gvh_A | 396 | Flavohemoprotein; oxidoreductase, NADP, heme, flav | 99.94 | |
| 1ash_A | 150 | Hemoglobin (OXY); oxygen storage; HET: HEM; 2.15A | 99.93 | |
| 2xki_A | 110 | Neural hemoglobin; oxygen storage, metal-binding; | 99.9 | |
| 2w31_A | 162 | Globin; oxygen transport, hexacoordination; HET: H | 99.6 | |
| 1or4_A | 178 | Heme-based aerotactic transducer hemat; globin fol | 99.08 | |
| 1s69_A | 124 | Cyanoglobin, hemoglobin, HB; on 2 helical fold, he | 98.89 | |
| 2bmm_A | 123 | Thermostable hemoglobin from thermobifida fusca; b | 98.66 | |
| 1ux8_A | 132 | YJBI protein; oxygen storage/transport, truncated | 98.45 | |
| 2gkm_A | 136 | TRHBN, hemoglobin-like protein HBN, flavohemoglobi | 98.41 | |
| 2bkm_A | 128 | Truncated hemoglobin from geobacillus stearothermo | 98.37 | |
| 2qrw_A | 128 | Hemoglobin-like protein HBO; truncated hemoglobin | 98.36 | |
| 1dlw_A | 116 | Hemoglobin; oxygen storage/transport complex; HET: | 98.21 | |
| 3aq9_A | 121 | Group 1 truncated hemoglobin; 2/2 fold hemoglobin, | 97.94 | |
| 2veb_A | 195 | Protoglobin; hemoprotein structure, protein matrix | 97.94 | |
| 1dly_A | 164 | Hemoglobin; oxygen storage/transport complex; HET: | 97.82 | |
| 2ksc_A | 123 | Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TR | 97.31 | |
| 2ig3_A | 127 | Group III truncated haemoglobin; truncated hemoglo | 96.63 | |
| 2xyk_A | 133 | 2-ON-2 hemoglobin; oxygen storage-transport comple | 96.34 |
| >1out_A Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-38 Score=222.33 Aligned_cols=138 Identities=13% Similarity=0.169 Sum_probs=130.0
Q ss_pred CCCCHHHHHHHHHHHHHHHhcchhhh---hhhccccCCchhhcCccCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhcc
Q 037487 1 MVFTEKQEALVNESWEILKEISHKIA---CVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLRE 77 (151)
Q Consensus 1 m~Lt~~e~~~i~~SW~~v~~~~~~~~---y~~lF~~~P~~~~~F~~~~~~~~~l~~~~~~~~H~~~v~~~l~~~i~~l~~ 77 (151)
|.||++|+++|++||+.+..+.+.+| |.|||+.+|+++++|+.|++.+ .+||++++|+.+|+++|+.+|.+|++
T Consensus 1 m~lt~~~~~~V~~sw~~v~~~~~~~g~~~~~rlF~~~P~~k~~F~~f~~~~---~~~~~~~~h~~~v~~al~~~v~~ld~ 77 (143)
T 1out_A 1 XSLTAKDKSVVKAFWGKISGKADVVGAEALGRMLTAYPQTKTYFSHWADLS---PGSGPVKKHGGIIMGAIGKAVGLMDD 77 (143)
T ss_dssp -CCCHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHSGGGGGGGTTSSCCS---TTCHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred CCCCHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHCccHHHHHHHcCCCC---CCCHHHHHHHHHHHHHHHHHHHhHHh
Confidence 78999999999999999999999998 9999999999999999998765 58999999999999999999888877
Q ss_pred cCchhhHHHHHHHHHHHHhh-CCCCCchHhHHHHHHHHHHHHHhcccChh-HHHHHHHHHHHHHHHHHHhhc
Q 037487 78 KGKVTVADTTLKYLGSVHLK-NGVLDPHFEVVKEALLRAIKEAVGEKWRD-MNCTWVEAYDQLAAAIKAEMK 147 (151)
Q Consensus 78 ~~~l~~~~~~l~~Lg~~H~~-~gv~~~~f~~~~~~ll~~l~~~lg~~~~~-~~~AW~~~~~~i~~~i~~~~~ 147 (151)
+ .+.|.+||++|.. +||+|+||+.+++||+.+|++.+|++||+ +++||.++|+.|++.|+.+|.
T Consensus 78 ---l---~~~l~~L~~~H~~~~~V~p~~f~~~~~~Ll~~l~~~lg~~~t~e~~~AW~k~~~~va~~l~~~y~ 143 (143)
T 1out_A 78 ---L---VGGMSALSDLHAFKLRVDPGNFKILSHNILVTLAIHFPSDFTPEVHIAVDKFLAAVSAALADKYR 143 (143)
T ss_dssp ---H---HHHTHHHHHHHHHTTCCCTHHHHHHHHHHHHHHHHHCTTTCCHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred ---H---HHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHccccCCHHHHHHHHHHHHHHHHHHHhhcC
Confidence 5 7889999999998 99999999999999999999999999999 999999999999999998774
|
| >4b4y_A Neuroglobin; transport protein, nervous system evolution, globin evolutio cnidarian, metazoan; HET: HEM; 2.30A {Symsagittifera roscoffensis} | Back alignment and structure |
|---|
| >1gdj_A Leghemoglobin (deoxy); oxygen transport; HET: HEM; 1.70A {Lupinus luteus} SCOP: a.1.1.2 PDB: 1gdi_A* 1gdk_A* 1gdl_A* 1lh1_A* 1lh2_A* 1lh3_A* 1lh5_A* 1lh6_A* 1lh7_A* 2gdm_A* 2lh1_A* 2lh2_A* 2lh3_A* 2lh5_A* 2lh6_A* 2lh7_A* | Back alignment and structure |
|---|
| >3bom_A Hemoglobin subunit alpha-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_A* | Back alignment and structure |
|---|
| >1xq5_A Hemoglobin alpha-1 chain; FISH hemoglobin, rapid oxidation, structural genomics, protein structure initiative, PSI, CESG; HET: HEM; 1.90A {Perca flavescens} SCOP: a.1.1.2 PDB: 3bj1_A* 3bj2_A* 3bj3_A* 3bcq_A* | Back alignment and structure |
|---|
| >1spg_A Hemoglobin; carbon monoxide, R-state, teleost FISH effect, oxygen transport; HET: HEM; 1.95A {Leiostomus xanthurus} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >2c0k_A Hemoglobin; oxygen transport, heme, iron, metal-binding; HET: HEM; 2.6A {Gasterophilus intestinalis} | Back alignment and structure |
|---|
| >3d1k_A Hemoglobin subunit alpha-1; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 2aa1_A* 1t1n_A* 1la6_A* 3nfe_A* 3ng6_A* 2h8f_A* 1pbx_A* 1s5x_A* 1s5y_A* 1hbh_A* 2h8d_A* 2peg_A* 3gkv_A* 3gqg_A* 1v4x_A* 1v4u_A* 1v4w_A* | Back alignment and structure |
|---|
| >1cg5_B Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_B* | Back alignment and structure |
|---|
| >1jeb_A Hemoglobin zeta chain; oxygen transport, oxygen storage/transport complex; HET: HEM; 2.10A {Homo sapiens} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >2dc3_A Cytoglobin; myoglobin, heme, oxygen transport, oxygen storage, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.68A {Homo sapiens} PDB: 1v5h_A* 3ag0_A* 1urv_A* 1umo_A* 1ury_A* 1ut0_A* 1ux9_A* | Back alignment and structure |
|---|
| >2bk9_A CG9734-PA; oxygen transport, drosophila melanogaster hemoglobin, heme hexacoordination, insect hemoglobin, protein cavities; HET: HEM CXS; 1.2A {Drosophila melanogaster} PDB: 2g3h_A* | Back alignment and structure |
|---|
| >1x46_A Globin chain, hemoglobin component VII; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.50A {Tokunagayusurika akamusi} | Back alignment and structure |
|---|
| >3pt8_B Hemoglobin III; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} PDB: 3pt7_B* | Back alignment and structure |
|---|
| >1cg5_A Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_A* | Back alignment and structure |
|---|
| >3d1k_B Hemoglobin subunit beta-1/2; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 1t1n_B* 1la6_B* 3nfe_B* 3ng6_B* 2h8f_B* 1pbx_B* 1s5x_B* 1s5y_B* 1hbh_B* 2h8d_B* 2peg_B* 3gkv_B* 3gqg_B* | Back alignment and structure |
|---|
| >2r80_A Hemoglobin subunit alpha-A; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3mju_A* 3dhr_A* 3mjp_A* 1faw_A* 3eok_A* 3k8b_A* 2qmb_A* 3fs4_A* 3a59_A* 1a4f_A* 1hv4_A* 2zfb_A* 1c40_A* 3at5_A* 3at6_A* | Back alignment and structure |
|---|
| >1a6m_A Myoglobin; heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates, oxygen transpor; HET: HEM; 1.00A {Physeter catodon} SCOP: a.1.1.2 PDB: 1a6k_A* 1a6n_A* 2jho_A* 1ufp_A* 2eb9_A* 2eb8_A* 2w6w_A* 2ekt_A* 105m_A* 104m_A* 1ajh_A* 1ajg_A* 1bvc_A* 1bvd_A* 1bz6_A* 1bzr_A* 1cq2_A* 1duk_A* 1ebc_A* 1hjt_A* ... | Back alignment and structure |
|---|
| >3pt8_A Hemoglobin II; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} SCOP: a.1.1.0 PDB: 3pi1_A* 2olp_A* 3pi3_A* 3pi4_A* 3pt7_A* 3pi2_A* | Back alignment and structure |
|---|
| >1hlb_A Hemoglobin (deoxy); oxygen transport; HET: HEM; 2.50A {Caudina arenicola} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >4hrt_A Globin-2 A chain; oxygen transport, globin fold, oxygen; HET: HEM; 1.46A {Scapharca inaequivalvis} PDB: 1sct_A* | Back alignment and structure |
|---|
| >1wmu_A Hemoglobin D alpha chain; hemoglobin D, reptilia, the aldabra giant tortoise, geochelone gigantea, oxygen storage/transport complex; HET: HEM; 1.65A {Dipsochelys dussumieri} SCOP: a.1.1.2 PDB: 1v75_A* 2z6n_A* 1hbr_A* | Back alignment and structure |
|---|
| >2aa1_B Hemoglobin beta-C chain; ROOT effect, cooperativity, antarctic FISH, oxygen storage/transport complex; HET: HEM; 1.80A {Trematomus newnesi} SCOP: a.1.1.2 PDB: 1xq5_B* 3bj1_B* 3bj2_B* 3bj3_B* | Back alignment and structure |
|---|
| >2oif_A Horvu GLB1, non-legume hemoglobin; hexacoordinate hemoglobin, barley, ligand binding, non- symbiotic, symbiotic, evolution; HET: HEM; 1.80A {Hordeum vulgare} PDB: 2r50_A* 1d8u_A* 2gnv_A* 2gnw_A* 3qqq_A* 3qqr_A* | Back alignment and structure |
|---|
| >1lhs_A Myoglobin; oxygen storage; HET: HEM; 2.00A {Caretta caretta} SCOP: a.1.1.2 PDB: 1lht_A* | Back alignment and structure |
|---|
| >1v4x_B Hemoglobin beta chain; oxygen transport, heme, respiratory protein, erythrocyte, ROOT effect, SWIM bladder, oxygen storage/transport complex; HET: HEM; 1.60A {Thunnus thynnus} SCOP: a.1.1.2 PDB: 1v4u_B* 1v4w_B* | Back alignment and structure |
|---|
| >2r80_B Hemoglobin subunit beta; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3dhr_B* 3mju_B* 1faw_B* 3k8b_B* 2qmb_B* 3eok_B* 1a4f_B* 1c40_B* 1hv4_B* 2zfb_B* 3mjp_B* 1hbr_B* 3fs4_B* 3a59_B* 1wmu_B* 1v75_B* 2z6n_B* 3at5_B* 3at6_B* | Back alignment and structure |
|---|
| >2w72_B Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7w_B* 1qi8_B* 1j7y_B* 1dxu_B* 1a0u_B* 1a0z_B* 1gli_B* 1j7s_B* 1o1l_B* 1o1n_B* 1y0t_B* 1y0w_B* 1o1o_B* 1ye2_B* 1y35_B* 1y22_B* 1ye0_B* 1dxt_B* 1y5f_B* 1ird_B* ... | Back alignment and structure |
|---|
| >4hrt_B Hemoglobin B chain; oxygen transport, globin fold, oxygen; HET: HEM; 1.46A {Scapharca inaequivalvis} PDB: 1sct_B* | Back alignment and structure |
|---|
| >1q1f_A Neuroglobin; globin fold, heme protein, oxygen storage/transport complex; HET: HEM; 1.50A {Mus musculus} SCOP: a.1.1.2 PDB: 1w92_A* 3gk9_A* 2vry_A* 3gkt_A* 3gln_A* 1oj6_A* | Back alignment and structure |
|---|
| >3mkb_A Hemoglobin subunit alpha; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} SCOP: a.1.1.2 PDB: 1gcv_A* 1gcw_A* | Back alignment and structure |
|---|
| >3bom_B Hemoglobin subunit beta-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_B* 3bcq_B* 1spg_B* | Back alignment and structure |
|---|
| >1hlm_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.90A {Caudina arenicola} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >1sct_A Hemoglobin II (carbonmonoxy) (alpha chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >2w72_C Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7s_A* 1qi8_A* 1j7y_A* 1o1i_A* 2w72_A* 1bzz_A* 1c7b_A* 1j7w_A* 1o1k_A* 1o1o_A* 1y0c_A* 1ydz_A* 3ia3_B* 1ird_A* 1a00_A* 1a0u_A* 1a0z_A* 1a3n_A* 1a9w_A* 1b86_A* ... | Back alignment and structure |
|---|
| >1mba_A Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysia limacina} SCOP: a.1.1.2 PDB: 2fal_A* 3mba_A* 4mba_A* 5mba_A* 2fam_A* 1dm1_A* | Back alignment and structure |
|---|
| >1sct_B Hemoglobin II (carbonmonoxy) (beta chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >1yhu_A Hemoglobin A1 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} | Back alignment and structure |
|---|
| >1jf3_A Monomer hemoglobin component III; oxygen storage/transport complex; HET: HEM; 1.40A {Glycera dibranchiata} SCOP: a.1.1.2 PDB: 1jl7_A* 1jf4_A* 1jl6_A* 1vre_A* 1vrf_A* 1hbg_A* 2hbg_A* | Back alignment and structure |
|---|
| >1out_B Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_B* | Back alignment and structure |
|---|
| >1x9f_B Erythrocruorin, globin II, extracellular, globin AIII, globin B; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_B* | Back alignment and structure |
|---|
| >1x3k_A Hemoglobin component V; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.64A {Tokunagayusurika akamusi} PDB: 2zwj_A* 3a5a_A* 3a5b_A* 3a5g_A* 3a9m_A* 3arj_A* 3ark_A* 3arl_A* | Back alignment and structure |
|---|
| >1ith_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.50A {Urechis caupo} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >1x9f_D Globin C, hemoglobin chain D1, globin III, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_D* | Back alignment and structure |
|---|
| >1x9f_C Erythrocruorin, globin III, extracellular, globin C; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_C* | Back alignment and structure |
|---|
| >1bin_A Leghemoglobin A; heme, nitrogen fixation, multigene family, oxygen transport; HET: HEM; 2.20A {Glycine max} SCOP: a.1.1.2 PDB: 1fsl_A* | Back alignment and structure |
|---|
| >3mkb_B Hemoglobin subunit beta; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >1yhu_D Hemoglobin B2 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} | Back alignment and structure |
|---|
| >1gcv_B Hemoglobin; oxygen storage/transport complex; HET: HEM; 2.00A {Mustelus griseus} SCOP: a.1.1.2 PDB: 1gcw_B* | Back alignment and structure |
|---|
| >2zs0_B Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_B* 2d2m_B* 2zfo_B* 2zs1_B* | Back alignment and structure |
|---|
| >1x9f_A Globin IV, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_A* | Back alignment and structure |
|---|
| >2zs0_A Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_A* 2d2m_A* 2zfo_A* 2zs1_A* | Back alignment and structure |
|---|
| >1yhu_C Hemoglobin B1A chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} | Back alignment and structure |
|---|
| >3g46_A Globin-1; oxygen transport, allostery, oxygen affinity, cytoplasm, heme, iron, metal-binding, oxygen storage/transport, oxygen binding; HET: HEM; 0.91A {Scapharca inaequivalvis} SCOP: a.1.1.2 PDB: 1nxf_A* 3g4q_A* 3g4r_A* 3g4u_A* 3g4v_A* 3g4w_A* 3g4y_A* 3g52_A* 3g53_A* 3uhg_A* 3uhs_A* 3uhk_A* 3uhi_A* 3uhn_A* 3ugy_A* 2auo_A* 2aup_A* 3uhr_A* 3uh5_A* 3uh3_A* ... | Back alignment and structure |
|---|
| >1b0b_A Hemoglobin; hemoprotein, sulfide carrier, globins, oxygen transport, oxygen storage/transport complex; HET: HEM; 1.43A {Lucina pectinata} SCOP: a.1.1.2 PDB: 1ebt_A* 1flp_A* 1moh_A* | Back alignment and structure |
|---|
| >3ubc_A Hemoglobin-like flavoprotein; oxygen-bound, autoxidation, nanotemplate, langmuir-blodgett, films, oxygen transport; HET: HEM; 1.65A {Methylacidiphilum infernorum V4} PDB: 3ubv_A* 3s1i_A* 3s1j_A* | Back alignment and structure |
|---|
| >2zs0_C Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_C* 2d2m_C* 2zfo_C* 2zs1_C* | Back alignment and structure |
|---|
| >3mvc_A Globin protein 6; oxygen sensor, heme-binding protein, C. elegans, OXY transport, electron transport; HET: HEM; 1.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1yhu_B Giant hemoglobins B chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} | Back alignment and structure |
|---|
| >1it2_A Hemoglobin; hagfish, deoxy form, oxygen storage/transport complex; HET: HEM; 1.60A {Eptatretus burgeri} SCOP: a.1.1.2 PDB: 1it3_A* | Back alignment and structure |
|---|
| >2lhb_A Hemoglobin V (cyano Met); oxygen transport; HET: HEM; 2.00A {Petromyzon marinus} SCOP: a.1.1.2 PDB: 3lhb_A* 1f5o_A* 1f5p_A* 1uc3_A* | Back alignment and structure |
|---|
| >2zs0_D Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2zfo_D* 2zs1_D* 2d2m_D* 2d2n_D* | Back alignment and structure |
|---|
| >2nrl_A Myoglobin; transport protein; HET: HEM; 0.91A {Thunnus atlanticus} PDB: 2nx0_A* 3qm5_A* 3qm6_A* 3qm7_A* 3qm8_A* 3qm9_A* 3qma_A* 1myt_A* 2nrm_A* | Back alignment and structure |
|---|
| >1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* | Back alignment and structure |
|---|
| >1eca_A Erythrocruorin (AQUO Met); oxygen transport; HET: HEM; 1.40A {Chironomus thummi thummi} SCOP: a.1.1.2 PDB: 1ecd_A* 1ecn_A* 1eco_A* | Back alignment and structure |
|---|
| >1h97_A Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitum} SCOP: a.1.1.2 PDB: 1kfr_A* | Back alignment and structure |
|---|
| >2wtg_A Globin-like protein; metal-binding, oxygen transport; HET: HEM; 1.50A {Caenorhabditis elegans} PDB: 2wth_A* | Back alignment and structure |
|---|
| >1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* | Back alignment and structure |
|---|
| >2vyw_A Hemoglobin; trematode, oxygen binding; HET: HEM; 1.8A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2vhb_A Hemoglobin; heme, respiratory protein, oxygen transport; HET: HEM; 1.76A {Vitreoscilla stercoraria} SCOP: a.1.1.2 PDB: 1vhb_A* 3vhb_A* 4vhb_A* | Back alignment and structure |
|---|
| >3lb2_A Dehaloperoxidase A; globin, oxidoreductase; HET: HEM; 1.06A {Amphitrite ornata} SCOP: a.1.1.2 PDB: 1ewa_A* 1ew6_A* 2qfk_A* 3kun_A* 3lb1_A* 3dr9_A* 3lb3_A* 3lb4_A* 3mou_A* 3ord_A* 3mym_A* 3k3u_A* 3o7n_A* 3kuo_A* 2qfn_A* 3myn_A* 3oj1_A* 3ok5_A* 3ixf_A* | Back alignment and structure |
|---|
| >2wy4_A Single domain haemoglobin; heme, transport, oxygen transport; HET: HEM; 1.35A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1tu9_A Hypothetical protein PA3967; structural genomics, heme, hemoglobin, pseudomonas aeruginos PSI, protein structure initiative; HET: HEM; 1.20A {Pseudomonas aeruginosa} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* | Back alignment and structure |
|---|
| >4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* | Back alignment and structure |
|---|
| >1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 | Back alignment and structure |
|---|
| >1ash_A Hemoglobin (OXY); oxygen storage; HET: HEM; 2.15A {Ascaris suum} SCOP: a.1.1.2 | Back alignment and structure |
|---|
| >2xki_A Neural hemoglobin; oxygen storage, metal-binding; HET: HEM SO4; 1.30A {Cerebratulus lacteus} PDB: 1kr7_A* 1v07_A* 2xkg_A* 2xkh_A* 2vyz_A* 2vyy_A* | Back alignment and structure |
|---|
| >2w31_A Globin; oxygen transport, hexacoordination; HET: HEM; 1.50A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1or4_A Heme-based aerotactic transducer hemat; globin fold, signaling protein; HET: HEM; 2.15A {Bacillus subtilis} SCOP: a.1.1.2 PDB: 1or6_A* | Back alignment and structure |
|---|
| >1s69_A Cyanoglobin, hemoglobin, HB; on 2 helical fold, heme, iron, cyanoba oxygen binding, hexacoordinate, truncated, oxygen storage-T complex; HET: FLC HEM; 1.68A {Synechocystis SP} SCOP: a.1.1.1 PDB: 1s6a_A* 1mwb_A* 1rtx_A* 2hz1_A* 2hz3_A* 2hz2_A* | Back alignment and structure |
|---|
| >2bmm_A Thermostable hemoglobin from thermobifida fusca; bacterial hemoglobin, thermostable protein, oxygen storage/transport; HET: HEM; 2.48A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1ux8_A YJBI protein; oxygen storage/transport, truncated hemoglobin, oxygen transport; HET: HEM; 2.15A {Bacillus subtilis} SCOP: a.1.1.1 | Back alignment and structure |
|---|
| >2gkm_A TRHBN, hemoglobin-like protein HBN, flavohemoglobin; truncated hemoglobin, mutant, oxygen storage/transport complex; HET: HEM; 1.73A {Mycobacterium tuberculosis} PDB: 1idr_A* 1rte_A* 1s56_A* 1s61_A* 2gl3_A* 2gln_A* 2gkn_A* | Back alignment and structure |
|---|
| >2bkm_A Truncated hemoglobin from geobacillus stearothermophilus; hypothetical protein, oxygen transport, transport, oxygen storage; HET: HEM; 1.5A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2qrw_A Hemoglobin-like protein HBO; truncated hemoglobin fold, alpha helix, heme, hydroxylation, iron, membrane, metal-binding; HET: HEM; 1.93A {Mycobacterium tuberculosis} PDB: 1ngk_A* | Back alignment and structure |
|---|
| >1dlw_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.54A {Paramecium caudatum} SCOP: a.1.1.1 PDB: 1uvy_A* | Back alignment and structure |
|---|
| >3aq9_A Group 1 truncated hemoglobin; 2/2 fold hemoglobin, nitric oxide detoxification, oxygen BIN; HET: HEM; 1.74A {Tetrahymena pyriformis} PDB: 3aq5_A* 3aq6_A* 3aq8_A* 3aq7_A* | Back alignment and structure |
|---|
| >2veb_A Protoglobin; hemoprotein structure, protein matrix tunnels, methanogenesis, archaea protein, transport protein; HET: HEM; 1.30A {Methanosarcina acetivorans} PDB: 2vee_A* 3r0g_A* 3qzz_A* 3qzx_A* | Back alignment and structure |
|---|
| >1dly_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.80A {Chlamydomonas eugametos} SCOP: a.1.1.1 PDB: 1uvx_A* | Back alignment and structure |
|---|
| >2ksc_A Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TRHBN, unknown function; HET: HEB; NMR {Synechococcus SP} | Back alignment and structure |
|---|
| >2ig3_A Group III truncated haemoglobin; truncated hemoglobin, 2-ON-2 globin, oxygen storage-transpor; HET: HEM; 2.15A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2xyk_A 2-ON-2 hemoglobin; oxygen storage-transport complex; HET: HEM; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 151 | ||||
| d2gdma_ | 153 | a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus | 9e-30 | |
| d1d8ua_ | 165 | a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice | 3e-27 | |
| d1fsla_ | 143 | a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), | 2e-25 | |
| d1b0ba_ | 142 | a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) | 2e-18 | |
| d1mbaa_ | 146 | a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia lim | 4e-18 | |
| d1hlba_ | 157 | a.1.1.2 (A:) Hemoglobin, different isoforms {Caudi | 4e-18 | |
| d1jl7a_ | 147 | a.1.1.2 (A:) Glycera globin {Marine bloodworm (Gly | 4e-18 | |
| d1x9fa_ | 147 | a.1.1.2 (A:) Extracellular dodecameric hemoglobin | 7e-17 | |
| d1cqxa1 | 150 | a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal doma | 9e-17 | |
| d1q1fa_ | 148 | a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [Ta | 5e-16 | |
| d1sctb_ | 150 | a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca ina | 6e-16 | |
| d1a6ma_ | 151 | a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter cato | 8e-16 | |
| d1x9fd_ | 140 | a.1.1.2 (D:) Extracellular dodecameric hemoglobin | 9e-16 | |
| d1gvha1 | 146 | a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal doma | 1e-15 | |
| d1hlma_ | 158 | a.1.1.2 (A:) Hemoglobin, different isoforms {Caudi | 1e-15 | |
| d1urva_ | 154 | a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [Tax | 2e-15 | |
| d1scta_ | 149 | a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca ina | 3e-15 | |
| d1x9fb_ | 145 | a.1.1.2 (B:) Extracellular dodecameric hemoglobin | 6e-15 | |
| d1ecda_ | 136 | a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thu | 1e-14 | |
| d1vhba_ | 144 | a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreos | 2e-14 | |
| d1x9fc_ | 149 | a.1.1.2 (C:) Extracellular dodecameric hemoglobin | 2e-13 | |
| d2dn3b1 | 145 | a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Human (H | 4e-13 | |
| d1h97a_ | 147 | a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Param | 4e-13 | |
| d1it2a_ | 146 | a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish ( | 1e-12 | |
| d3sdha_ | 145 | a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca ina | 2e-12 | |
| d1lhta_ | 153 | a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Car | 5e-12 | |
| d2lhba_ | 149 | a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyz | 2e-11 | |
| d1outb_ | 146 | a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorh | 6e-11 | |
| d1v4wb_ | 146 | a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna | 1e-10 | |
| d1itha_ | 141 | a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis c | 1e-10 | |
| d1kr7a_ | 110 | a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural | 2e-10 | |
| d1myta_ | 146 | a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus al | 3e-10 | |
| d1jeba_ | 141 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo | 1e-09 | |
| d1spga_ | 143 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiost | 3e-09 | |
| d1outa_ | 142 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncor | 3e-09 | |
| d2qfka1 | 137 | a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite orn | 3e-09 | |
| d1wmub_ | 146 | a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant | 4e-09 | |
| d3d1ka1 | 142 | a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarct | 5e-09 | |
| d1cg5b_ | 141 | a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous | 5e-09 | |
| d2aa1b1 | 146 | a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarcti | 8e-09 | |
| d3d1kb1 | 146 | a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarcti | 2e-08 | |
| d1wmua_ | 141 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra gian | 2e-08 | |
| d2dn3a1 | 140 | a.1.1.2 (A:2-141) Hemoglobin, alpha-chain {Human ( | 2e-08 | |
| d1tu9a_ | 131 | a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomo | 4e-08 | |
| d1spgb_ | 147 | a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiosto | 7e-08 | |
| d1xq5a_ | 142 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch | 9e-08 | |
| d1cg5a_ | 141 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginou | 2e-07 | |
| d1a4fa_ | 141 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed g | 3e-07 | |
| d1gcva_ | 140 | a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark ( | 2e-06 | |
| d1gcvb_ | 136 | a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (M | 7e-04 |
| >d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]} Length = 153 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Globin-like superfamily: Globin-like family: Globins domain: Leghemoglobin species: Yellow lupin (Lupinus luteus) [TaxId: 3873]
Score = 103 bits (258), Expect = 9e-30
Identities = 79/152 (51%), Positives = 95/152 (62%), Gaps = 5/152 (3%)
Query: 3 FTEKQEALVNESWEILKEISHKIACV---SSPQIAPAAKGMFSFLRDSDGIPQNNPKLKA 59
TE Q ALV SWE K +IAPAAK +FSFL+ + +PQNNP+L+A
Sbjct: 3 LTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQA 62
Query: 60 HAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEA 119
HA KVFK+ E+AIQL G V D TLK LGSVH+ GV D HF VVKEA+L+ IKE
Sbjct: 63 HAGKVFKLVYEAAIQLEVTGV-VVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEV 121
Query: 120 VGEKW-RDMNCTWVEAYDQLAAAIKAEMKEEA 150
VG KW ++N W AYD+LA IK EM + A
Sbjct: 122 VGAKWSEELNSAWTIAYDELAIVIKKEMDDAA 153
|
| >d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]} Length = 165 | Back information, alignment and structure |
|---|
| >d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]} Length = 143 | Back information, alignment and structure |
|---|
| >d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]} Length = 142 | Back information, alignment and structure |
|---|
| >d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]} Length = 146 | Back information, alignment and structure |
|---|
| >d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Length = 157 | Back information, alignment and structure |
|---|
| >d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]} Length = 147 | Back information, alignment and structure |
|---|
| >d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 147 | Back information, alignment and structure |
|---|
| >d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 150 | Back information, alignment and structure |
|---|
| >d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 | Back information, alignment and structure |
|---|
| >d1sctb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Length = 150 | Back information, alignment and structure |
|---|
| >d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} Length = 151 | Back information, alignment and structure |
|---|
| >d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 140 | Back information, alignment and structure |
|---|
| >d1gvha1 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 146 | Back information, alignment and structure |
|---|
| >d1hlma_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Length = 158 | Back information, alignment and structure |
|---|
| >d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1scta_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Length = 149 | Back information, alignment and structure |
|---|
| >d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 145 | Back information, alignment and structure |
|---|
| >d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]} Length = 136 | Back information, alignment and structure |
|---|
| >d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]} Length = 144 | Back information, alignment and structure |
|---|
| >d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 149 | Back information, alignment and structure |
|---|
| >d2dn3b1 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]} Length = 147 | Back information, alignment and structure |
|---|
| >d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]} Length = 146 | Back information, alignment and structure |
|---|
| >d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Length = 145 | Back information, alignment and structure |
|---|
| >d1lhta_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]} Length = 153 | Back information, alignment and structure |
|---|
| >d2lhba_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} Length = 149 | Back information, alignment and structure |
|---|
| >d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Length = 146 | Back information, alignment and structure |
|---|
| >d1v4wb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} Length = 146 | Back information, alignment and structure |
|---|
| >d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]} Length = 141 | Back information, alignment and structure |
|---|
| >d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]} Length = 110 | Back information, alignment and structure |
|---|
| >d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]} Length = 146 | Back information, alignment and structure |
|---|
| >d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Length = 143 | Back information, alignment and structure |
|---|
| >d1outa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Length = 142 | Back information, alignment and structure |
|---|
| >d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wmub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Length = 146 | Back information, alignment and structure |
|---|
| >d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Length = 142 | Back information, alignment and structure |
|---|
| >d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Length = 141 | Back information, alignment and structure |
|---|
| >d2aa1b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Length = 146 | Back information, alignment and structure |
|---|
| >d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Length = 146 | Back information, alignment and structure |
|---|
| >d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Length = 141 | Back information, alignment and structure |
|---|
| >d2dn3a1 a.1.1.2 (A:2-141) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]} Length = 131 | Back information, alignment and structure |
|---|
| >d1spgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Length = 147 | Back information, alignment and structure |
|---|
| >d1xq5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens) [TaxId: 8167]} Length = 142 | Back information, alignment and structure |
|---|
| >d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Length = 141 | Back information, alignment and structure |
|---|
| >d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]} Length = 141 | Back information, alignment and structure |
|---|
| >d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Length = 140 | Back information, alignment and structure |
|---|
| >d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 151 | |||
| d2gdma_ | 153 | Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxI | 100.0 | |
| d1d8ua_ | 165 | Non-symbiotic plant hemoglobin {Rice (Oryza sativa | 100.0 | |
| d1urva_ | 154 | Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1cg5b_ | 141 | Hemoglobin, beta-chain {Cartilaginous fish akaei ( | 100.0 | |
| d1fsla_ | 143 | Leghemoglobin {Soybean (Glycine max), isoform A [T | 100.0 | |
| d1xq5a_ | 142 | Hemoglobin, alpha-chain {Yellow perch (Perca flave | 100.0 | |
| d1wmua_ | 141 | Hemoglobin, alpha-chain {Aldabra giant tortoise (G | 100.0 | |
| d1jeba_ | 141 | Hemoglobin, alpha-chain {Human (Homo sapiens), zet | 100.0 | |
| d1lhta_ | 153 | Myoglobin {Loggerhead sea turtle (Caretta caretta) | 100.0 | |
| d1outa_ | 142 | Hemoglobin, alpha-chain {Trout (Oncorhynchus mykis | 100.0 | |
| d3d1ka1 | 142 | Hemoglobin, alpha-chain {Antarctic fish (Trematomu | 100.0 | |
| d1a4fa_ | 141 | Hemoglobin, alpha-chain {Bar-headed goose (Anser i | 100.0 | |
| d1hlma_ | 158 | Hemoglobin, different isoforms {Caudina arenicola, | 100.0 | |
| d1spga_ | 143 | Hemoglobin, alpha-chain {Fish (Leiostomus xanthuru | 100.0 | |
| d3d1kb1 | 146 | Hemoglobin, beta-chain {Antarctic fish (Trematomus | 100.0 | |
| d1a6ma_ | 151 | Myoglobin {Sperm whale (Physeter catodon) [TaxId: | 100.0 | |
| d1hlba_ | 157 | Hemoglobin, different isoforms {Caudina arenicola, | 100.0 | |
| d1cg5a_ | 141 | Hemoglobin, alpha-chain {Cartilaginous fish akaei | 100.0 | |
| d1v4wb_ | 146 | Hemoglobin, beta-chain {Bluefin tuna (Thunnus thyn | 100.0 | |
| d2dn3b1 | 145 | Hemoglobin, beta-chain {Human (Homo sapiens) [TaxI | 100.0 | |
| d1q1fa_ | 148 | Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} | 100.0 | |
| d1gcva_ | 140 | Hemoglobin, alpha-chain {Houndshark (Mustelus gris | 100.0 | |
| d2dn3a1 | 140 | Hemoglobin, alpha-chain {Human (Homo sapiens) [Tax | 100.0 | |
| d1jl7a_ | 147 | Glycera globin {Marine bloodworm (Glycera dibranch | 100.0 | |
| d1wmub_ | 146 | Hemoglobin, beta-chain {Aldabra giant tortoise (Ge | 100.0 | |
| d1mbaa_ | 146 | Myoglobin {Slug sea hare (Aplysia limacina) [TaxId | 100.0 | |
| d2aa1b1 | 146 | Hemoglobin, beta-chain {Antarctic fish (Trematomus | 100.0 | |
| d1gcvb_ | 136 | Hemoglobin, beta-chain {Houndshark (Mustelus grise | 100.0 | |
| d1outb_ | 146 | Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss | 100.0 | |
| d1scta_ | 149 | Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ | 100.0 | |
| d1spgb_ | 147 | Hemoglobin, beta-chain {Fish (Leiostomus xanthurus | 100.0 | |
| d1cqxa1 | 150 | Flavohemoglobin, N-terminal domain {Alcaligenes eu | 100.0 | |
| d1vhba_ | 144 | Bacterial dimeric hemoglobin {Vitreoscilla stercor | 100.0 | |
| d1b0ba_ | 142 | Hemoglobin I {Clam (Lucina pectinata) [TaxId: 2916 | 100.0 | |
| d1itha_ | 141 | Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: | 100.0 | |
| d1myta_ | 146 | Myoglobin {Yellowfin tuna (Thunnus albacares) [Tax | 100.0 | |
| d3sdha_ | 145 | Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ | 100.0 | |
| d1sctb_ | 150 | Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ | 100.0 | |
| d1x9fb_ | 145 | Extracellular dodecameric hemoglobin (erythrocruor | 100.0 | |
| d1gvha1 | 146 | Flavohemoglobin, N-terminal domain {Escherichia co | 100.0 | |
| d1it2a_ | 146 | Hagfish hemoglobin {Inshore hagfish (Eptatretus bu | 100.0 | |
| d2lhba_ | 149 | Lamprey globin {Sea lamprey (Petromyzon marinus) [ | 100.0 | |
| d1ecda_ | 136 | Erythrocruorin {Midge (Chironomus thummi thummi), | 100.0 | |
| d1x9fd_ | 140 | Extracellular dodecameric hemoglobin (erythrocruor | 100.0 | |
| d1h97a_ | 147 | Trematode hemoglobin/myoglobin {Paramphistomum epi | 100.0 | |
| d1x9fc_ | 149 | Extracellular dodecameric hemoglobin (erythrocruor | 100.0 | |
| d1x9fa_ | 147 | Extracellular dodecameric hemoglobin (erythrocruor | 99.98 | |
| d2qfka1 | 137 | Dehaloperoxidase {Amphitrite ornata [TaxId: 129555 | 99.97 | |
| d1asha_ | 147 | Ascaris hemoglobin, domain 1 {Pig roundworm (Ascar | 99.95 | |
| d1tu9a_ | 131 | Hypothetical protein PA3967 {Pseudomonas aeruginos | 99.93 | |
| d1kr7a_ | 110 | Nerve tissue mini-hemoglobin (neural globin) {Milk | 99.92 | |
| d1or4a_ | 169 | Heme-based aerotactic transducer HemAT, sensor dom | 99.11 | |
| d1dlya_ | 121 | Protozoan/bacterial hemoglobin {Green alga (Chlamy | 97.65 | |
| d1ngka_ | 126 | Protozoan/bacterial hemoglobin {Mycobacterium tube | 97.43 | |
| d1dlwa_ | 116 | Protozoan/bacterial hemoglobin {Ciliate (Parameciu | 97.4 | |
| d1ux8a_ | 119 | Protozoan/bacterial hemoglobin {Bacillus subtilis | 97.22 | |
| d1idra_ | 127 | Protozoan/bacterial hemoglobin {Mycobacterium tube | 97.15 | |
| d1s69a_ | 123 | Protozoan/bacterial hemoglobin {Cyanobacteria (Syn | 94.78 |
| >d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Globin-like superfamily: Globin-like family: Globins domain: Leghemoglobin species: Yellow lupin (Lupinus luteus) [TaxId: 3873]
Probab=100.00 E-value=5.8e-40 Score=230.92 Aligned_cols=148 Identities=54% Similarity=0.831 Sum_probs=137.6
Q ss_pred CCCHHHHHHHHHHHHHHHhcchhhh---hhhccccCCchhhcCccCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhccc
Q 037487 2 VFTEKQEALVNESWEILKEISHKIA---CVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREK 78 (151)
Q Consensus 2 ~Lt~~e~~~i~~SW~~v~~~~~~~~---y~~lF~~~P~~~~~F~~~~~~~~~l~~~~~~~~H~~~v~~~l~~~i~~l~~~ 78 (151)
+||++|+++|++||+.+.++...+| |.+||+.||++|++|+.+++....+.++|.|+.|+.+|+..++.+|.+|+++
T Consensus 2 ~Lt~~q~~li~~SW~~v~~~~~~~g~~~f~~lF~~~P~~k~~F~~~~~~~~~~~~~~~~~~h~~~v~~~l~~~i~~ld~~ 81 (153)
T d2gdma_ 2 ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLEVT 81 (153)
T ss_dssp CCCHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHCGGGGGGCTTTTTCSSCCSSCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHCHHHHHHhhhcCCCchhhhcCHHHHHHHHHHHHHHHHHHHhhccc
Confidence 6999999999999999999999998 9999999999999999876655577999999999999999999999999987
Q ss_pred CchhhHHHHHHHHHHHHhhCCCCCchHhHHHHHHHHHHHHHhcccChh-HHHHHHHHHHHHHHHHHHhhchhh
Q 037487 79 GKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRD-MNCTWVEAYDQLAAAIKAEMKEEA 150 (151)
Q Consensus 79 ~~l~~~~~~l~~Lg~~H~~~gv~~~~f~~~~~~ll~~l~~~lg~~~~~-~~~AW~~~~~~i~~~i~~~~~~~~ 150 (151)
+.+ .+...+++||++|.+|||+|+||+.|+++|+.++++.+|..|++ +++||.++|+.|++.|+++|+++|
T Consensus 82 ~~~-~~~~~l~~lg~~H~~~gv~~~~f~~~~~~l~~~i~~~lg~~~~~e~~~AW~~~~~~i~~~~~~~~~~~a 153 (153)
T d2gdma_ 82 GVV-VTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKEMDDAA 153 (153)
T ss_dssp SSC-CCCHHHHHHHHHHHHTTCCGGGHHHHHHHHHHHHHHHHGGGCCHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred chh-hHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHhCccCCHHHHHHHHHHHHHHHHHHHHHhhhcC
Confidence 754 12467999999999999999999999999999999999999999 999999999999999999998875
|
| >d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} | Back information, alignment and structure |
|---|
| >d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1xq5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens) [TaxId: 8167]} | Back information, alignment and structure |
|---|
| >d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} | Back information, alignment and structure |
|---|
| >d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lhta_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]} | Back information, alignment and structure |
|---|
| >d1outa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} | Back information, alignment and structure |
|---|
| >d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} | Back information, alignment and structure |
|---|
| >d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]} | Back information, alignment and structure |
|---|
| >d1hlma_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} | Back information, alignment and structure |
|---|
| >d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} | Back information, alignment and structure |
|---|
| >d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} | Back information, alignment and structure |
|---|
| >d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} | Back information, alignment and structure |
|---|
| >d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} | Back information, alignment and structure |
|---|
| >d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} | Back information, alignment and structure |
|---|
| >d1v4wb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} | Back information, alignment and structure |
|---|
| >d2dn3b1 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} | Back information, alignment and structure |
|---|
| >d2dn3a1 a.1.1.2 (A:2-141) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]} | Back information, alignment and structure |
|---|
| >d1wmub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} | Back information, alignment and structure |
|---|
| >d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]} | Back information, alignment and structure |
|---|
| >d2aa1b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} | Back information, alignment and structure |
|---|
| >d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} | Back information, alignment and structure |
|---|
| >d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} | Back information, alignment and structure |
|---|
| >d1scta_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} | Back information, alignment and structure |
|---|
| >d1spgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} | Back information, alignment and structure |
|---|
| >d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]} | Back information, alignment and structure |
|---|
| >d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]} | Back information, alignment and structure |
|---|
| >d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]} | Back information, alignment and structure |
|---|
| >d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]} | Back information, alignment and structure |
|---|
| >d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} | Back information, alignment and structure |
|---|
| >d1sctb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} | Back information, alignment and structure |
|---|
| >d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1gvha1 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]} | Back information, alignment and structure |
|---|
| >d2lhba_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} | Back information, alignment and structure |
|---|
| >d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]} | Back information, alignment and structure |
|---|
| >d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]} | Back information, alignment and structure |
|---|
| >d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]} | Back information, alignment and structure |
|---|
| >d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]} | Back information, alignment and structure |
|---|
| >d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dlya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]} | Back information, alignment and structure |
|---|
| >d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]} | Back information, alignment and structure |
|---|
| >d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]} | Back information, alignment and structure |
|---|