Citrus Sinensis ID: 037487


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MVFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMKEEAA
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHHHHHHHHcccHHcc
MVFTEKQEALVNESWEILKEISHKiacvsspqiapaAKGMFSflrdsdgipqnnpklkAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGsvhlkngvldpHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMKEEAA
mvftekqeALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGsvhlkngvldPHFEVVKEALLRAIKEAvgekwrdmnCTWVEAYDQLAAAIKAEMKEEAA
MVFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLaaaikaemkeeaa
*********LVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLR**********KLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAI*********
*VFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFL**************AHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMK****
********ALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMKEEAA
*VFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFTEKQEALVNESWEILKEISHKIACVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRDMNCTWVEAYDQLAAAIKAEMKEEAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q941Q2161 Non-symbiotic hemoglobin N/A no 0.986 0.925 0.712 1e-55
O24521158 Non-symbiotic hemoglobin yes no 0.973 0.930 0.708 2e-55
Q93Y92159 Non-symbiotic hemoglobin N/A no 0.973 0.924 0.736 1e-54
Q941P9156 Non-symbiotic hemoglobin N/A no 1.0 0.967 0.670 2e-53
Q42665152 Hemoglobin A OS=Casuarina N/A no 0.980 0.973 0.572 1e-42
P08054152 Hemoglobin-1 OS=Casuarina N/A no 0.980 0.973 0.565 2e-41
O24520160 Non-symbiotic hemoglobin no no 0.966 0.912 0.573 4e-39
P42511149 Leghemoglobin OS=Canavali N/A no 0.920 0.932 0.594 6e-39
P14848148 Leghemoglobin 2 OS=Sesban N/A no 0.947 0.966 0.573 7e-39
Q947C5163 Non-symbiotic hemoglobin N/A no 0.966 0.895 0.56 2e-38
>sp|Q941Q2|HBL2_BRANA Non-symbiotic hemoglobin 2 OS=Brassica napus GN=HB2 PE=3 SV=1 Back     alignment and function desciption
 Score =  214 bits (546), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 125/153 (81%), Gaps = 4/153 (2%)

Query: 1   MVFTEKQEALVNESWEILKEISHKIACVSSPQI---APAAKGMFSFLRDSDGIPQNNPKL 57
           +VFTEKQEALV ESWEILK+   K +     QI   APAAK MFSFLRD+D +P NNPKL
Sbjct: 4   IVFTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKDMFSFLRDTDEVPHNNPKL 63

Query: 58  KAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIK 117
           KAHAVKVFKMTCE+AIQLREKGKV VADTTL+YLGSVH K+GVLDPHFEVVKEAL+R +K
Sbjct: 64  KAHAVKVFKMTCETAIQLREKGKVVVADTTLQYLGSVHFKSGVLDPHFEVVKEALVRTLK 123

Query: 118 EAVGEKWR-DMNCTWVEAYDQLAAAIKAEMKEE 149
           E +GEK+  ++   W +AYD LA AIKAEMK+E
Sbjct: 124 EGLGEKYNEEVEGAWSKAYDHLALAIKAEMKQE 156




May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule.
Brassica napus (taxid: 3708)
>sp|O24521|HBL2_ARATH Non-symbiotic hemoglobin 2 OS=Arabidopsis thaliana GN=AHB2 PE=1 SV=1 Back     alignment and function description
>sp|Q93Y92|HBL2_GOSHI Non-symbiotic hemoglobin 2 OS=Gossypium hirsutum GN=HB2 PE=3 SV=1 Back     alignment and function description
>sp|Q941P9|HBL2_SOLLC Non-symbiotic hemoglobin 2 OS=Solanum lycopersicum GN=HB2 PE=2 SV=1 Back     alignment and function description
>sp|Q42665|HBPA_CASGL Hemoglobin A OS=Casuarina glauca GN=SYMA PE=2 SV=3 Back     alignment and function description
>sp|P08054|HBP1_CASGL Hemoglobin-1 OS=Casuarina glauca PE=1 SV=2 Back     alignment and function description
>sp|O24520|HBL1_ARATH Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana GN=AHB1 PE=1 SV=1 Back     alignment and function description
>sp|P42511|LGB_CANLI Leghemoglobin OS=Canavalia lineata PE=2 SV=1 Back     alignment and function description
>sp|P14848|LGB2_SESRO Leghemoglobin 2 OS=Sesbania rostrata GN=GLB2 PE=1 SV=2 Back     alignment and function description
>sp|Q947C5|HBL1_GOSHI Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum GN=HB1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
297833826159 non-symbiotic hemoglobin 2 [Arabidopsis 0.973 0.924 0.721 1e-54
22001642161 RecName: Full=Non-symbiotic hemoglobin 2 0.986 0.925 0.712 7e-54
410129747155 hypothetical protein [Beta vulgaris] 0.993 0.967 0.698 1e-53
15228313158 non-symbiotic hemoglobin 2 [Arabidopsis 0.973 0.930 0.708 1e-53
312282137158 unnamed protein product [Thellungiella h 0.986 0.943 0.705 5e-53
22001640159 RecName: Full=Non-symbiotic hemoglobin 2 0.973 0.924 0.736 7e-53
350538955156 non-symbiotic hemoglobin 2 [Solanum lyco 1.0 0.967 0.670 9e-52
449449389151 PREDICTED: non-symbiotic hemoglobin 2-li 0.973 0.973 0.668 2e-50
3297847161 nonsymbiotic hemoglobin [Cichorium intyb 1.0 0.937 0.625 5e-48
7801697165 hemoglobin [Cichorium intybus x Cichoriu 0.986 0.903 0.642 8e-48
>gi|297833826|ref|XP_002884795.1| non-symbiotic hemoglobin 2 [Arabidopsis lyrata subsp. lyrata] gi|297330635|gb|EFH61054.1| non-symbiotic hemoglobin 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 124/151 (82%), Gaps = 4/151 (2%)

Query: 3   FTEKQEALVNESWEILKEISHKIACVSSPQI---APAAKGMFSFLRDSDGIPQNNPKLKA 59
           FTEKQEALV ESWEILK+   K +     QI   APAAKG+FSFLRDSD +P NNPKLKA
Sbjct: 6   FTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKGLFSFLRDSDEVPHNNPKLKA 65

Query: 60  HAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEA 119
           HAVKVFKMTCE+AIQLREKGKV VADTTL+YLGS+HLK+GV+DPHFEVVKEALLR +KE 
Sbjct: 66  HAVKVFKMTCETAIQLREKGKVVVADTTLQYLGSIHLKSGVIDPHFEVVKEALLRTLKEG 125

Query: 120 VGEKWR-DMNCTWVEAYDQLAAAIKAEMKEE 149
           +GEK+  D+   W +AYD LA AIK EMK+E
Sbjct: 126 LGEKYNEDVEGGWSQAYDHLALAIKTEMKQE 156




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|22001642|sp|Q941Q2.1|HBL2_BRANA RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=BRAna GLB2; AltName: Full=Hb2 gi|15809392|gb|AAK07741.1| class 2 non-symbiotic hemoglobin [Brassica napus] Back     alignment and taxonomy information
>gi|410129747|dbj|BAM64826.1| hypothetical protein [Beta vulgaris] Back     alignment and taxonomy information
>gi|15228313|ref|NP_187663.1| non-symbiotic hemoglobin 2 [Arabidopsis thaliana] gi|17432971|sp|O24521.1|HBL2_ARATH RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=ARAth GLB2; Short=Hb2 gi|12322784|gb|AAG51381.1|AC011560_13 class 2 non-symbiotic hemoglobin; 69592-70841 [Arabidopsis thaliana] gi|2581785|gb|AAB82770.1| class 2 non-symbiotic hemoglobin [Arabidopsis thaliana] gi|8567781|gb|AAF76353.1| class 2 non-symbiotic hemoglobin [Arabidopsis thaliana] gi|21593239|gb|AAM65188.1| Non-symbiotic hemoglobin Hb2 [Arabidopsis thaliana] gi|114050613|gb|ABI49456.1| At3g10520 [Arabidopsis thaliana] gi|332641398|gb|AEE74919.1| non-symbiotic hemoglobin 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282137|dbj|BAJ33934.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|22001640|sp|Q93Y92.1|HBL2_GOSHI RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=GOShi GLB2; Short=Hb2 gi|15809418|gb|AAK21604.1| non-symbiotic hemoglobin class 2 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|350538955|ref|NP_001234111.1| non-symbiotic hemoglobin 2 [Solanum lycopersicum] gi|22001641|sp|Q941P9.1|HBL2_SOLLC RecName: Full=Non-symbiotic hemoglobin 2; AltName: Full=Hb2; AltName: Full=SOLly GLB2 gi|15809398|gb|AAK07677.1| non-symbiotic hemoglobin class 2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449449389|ref|XP_004142447.1| PREDICTED: non-symbiotic hemoglobin 2-like [Cucumis sativus] gi|449524778|ref|XP_004169398.1| PREDICTED: non-symbiotic hemoglobin 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|3297847|emb|CAA07547.1| nonsymbiotic hemoglobin [Cichorium intybus x Cichorium endivia] Back     alignment and taxonomy information
>gi|7801697|emb|CAB91629.1| hemoglobin [Cichorium intybus x Cichorium endivia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
TAIR|locus:2075780158 HB2 "haemoglobin 2" [Arabidops 0.900 0.860 0.707 3.3e-47
TAIR|locus:2052981160 HB1 "hemoglobin 1" [Arabidopsi 0.907 0.856 0.566 2.2e-34
ZFIN|ZDB-GENE-011102-1159 ngb "neuroglobin" [Danio rerio 0.854 0.811 0.253 4.3e-06
TAIR|locus:2075780 HB2 "haemoglobin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 494 (179.0 bits), Expect = 3.3e-47, P = 3.3e-47
 Identities = 99/140 (70%), Positives = 115/140 (82%)

Query:     3 FTEKQEALVNESWEILKEISHKIACVSSPQI---APAAKGMFSFLRDSDGIPQNNPKLKA 59
             FTEKQEALV ESWEILK+   K +     QI   APAAKG+FSFLRDSD +P NNPKLKA
Sbjct:     6 FTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKGLFSFLRDSDEVPHNNPKLKA 65

Query:    60 HAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEA 119
             HAVKVFKMTCE+AIQLRE+GKV VADTTL+YLGS+HLK+GV+DPHFEVVKEALLR +KE 
Sbjct:    66 HAVKVFKMTCETAIQLREEGKVVVADTTLQYLGSIHLKSGVIDPHFEVVKEALLRTLKEG 125

Query:   120 VGEKWRD-MNCTWVEAYDQL 138
             +GEK+ + +   W +AYD L
Sbjct:   126 LGEKYNEEVEGAWSQAYDHL 145




GO:0005506 "iron ion binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0009735 "response to cytokinin stimulus" evidence=IEP
GO:0015671 "oxygen transport" evidence=IEA
GO:0019825 "oxygen binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0006631 "fatty acid metabolic process" evidence=IMP
GO:0019432 "triglyceride biosynthetic process" evidence=IMP
GO:0005344 "oxygen transporter activity" evidence=ISS
TAIR|locus:2052981 HB1 "hemoglobin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-011102-1 ngb "neuroglobin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P07803HBL_TRETONo assigned EC number0.55330.96020.9006N/Ano
P93849LGB3_VICFANo assigned EC number0.51670.94030.9726N/Ano
P23244HBP2_CASGLNo assigned EC number0.55030.96020.9062N/Ano
Q941P9HBL2_SOLLCNo assigned EC number0.67091.00.9679N/Ano
Q42831HBL_HORVUNo assigned EC number0.55920.97350.9074N/Ano
Q947C5HBL1_GOSHINo assigned EC number0.560.96680.8957N/Ano
Q9SAZ0LGB6_PEANo assigned EC number0.54360.94030.9726N/Ano
Q9SAZ1LGB4_PEANo assigned EC number0.54360.94030.9726N/Ano
P27993LGB2_MEDTRNo assigned EC number0.53690.94030.9726N/Ano
P27992LGB1_MEDTRNo assigned EC number0.50660.94030.9659N/Ano
Q9M593HBL_ZEAMPNo assigned EC number0.54830.99330.9090N/Ano
O04986HBL1_ORYSJNo assigned EC number0.59330.96020.8734yesno
P02232LGB1_VICFANo assigned EC number0.52020.92050.9652N/Ano
O48665LGB5_PEANo assigned EC number0.52340.94030.9726N/Ano
P02234LGBA_PHAVUNo assigned EC number0.52410.89400.9246N/Ano
Q9FVL0HBL1_MEDSANo assigned EC number0.55030.96020.9062N/Ano
P28010LGB4_MEDSANo assigned EC number0.54660.94030.9659N/Ano
Q941Q2HBL2_BRANANo assigned EC number0.71240.98670.9254N/Ano
O80405LGB3_PEANo assigned EC number0.55030.94030.9726N/Ano
P08054HBP1_CASGLNo assigned EC number0.56570.98010.9736N/Ano
P10816LGB3_SESRONo assigned EC number0.560.94700.9662N/Ano
P02239LGB1_LUPLUNo assigned EC number0.51940.97350.9545N/Ano
Q42665HBPA_CASGLNo assigned EC number0.57230.98010.9736N/Ano
O48668LGB2_PEANo assigned EC number0.50660.94030.9659N/Ano
P14962LGB3_MEDSANo assigned EC number0.53690.94030.9726N/Ano
P09187LGB1_MEDSANo assigned EC number0.51330.94030.9659N/Ano
P14848LGB2_SESRONo assigned EC number0.57330.94700.9662N/Ano
Q93Y92HBL2_GOSHINo assigned EC number0.73680.97350.9245N/Ano
Q9FY42HBL_MAIZENo assigned EC number0.54190.99330.9090N/Ano
P27199LGB_PSOTENo assigned EC number0.51720.89400.9310N/Ano
P42511LGB_CANLINo assigned EC number0.59450.92050.9328N/Ano
Q43236LGB1_VIGUNNo assigned EC number0.50340.90720.9448N/Ano
P68169HBPL_PARRINo assigned EC number0.52660.96680.9012N/Ano
P68168HBPL_PARADNo assigned EC number0.52660.96680.9012N/Ano
P02240LGB2_LUPLUNo assigned EC number0.52280.96680.9480N/Ano
O04939LGB2_PHAVUNo assigned EC number0.51030.89400.9246N/Ano
O24521HBL2_ARATHNo assigned EC number0.70860.97350.9303yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
cd01040140 cd01040, globin, Globins are heme proteins, which 1e-18
pfam00042108 pfam00042, Globin, Globin 1e-11
PRK13289 399 PRK13289, PRK13289, bifunctional nitric oxide diox 0.003
>gnl|CDD|238510 cd01040, globin, Globins are heme proteins, which bind and transport oxygen Back     alignment and domain information
 Score = 76.3 bits (188), Expect = 1e-18
 Identities = 37/147 (25%), Positives = 61/147 (41%), Gaps = 15/147 (10%)

Query: 4   TEKQEALVNESWEILKEISHKIACVSSPQI-------APAAKGMFSFLRDSDGIPQNNPK 56
           + +++ LV  SW  LK    +I      +         P  + +FS         + +PK
Sbjct: 1   SAEEKKLVKASWAKLKADREEIG----LEFYERLFKAHPETRALFSRFGGLSAALKGSPK 56

Query: 57  LKAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAI 116
            KAH  +V     E+   L +   +      L  LG  H K GV   HF++  EALL  +
Sbjct: 57  FKAHGKRVLNALDEAIKNLDDLEAL---KALLAKLGRKHAKRGVDPEHFKLFGEALLEVL 113

Query: 117 KEAVGEKWRD-MNCTWVEAYDQLAAAI 142
            E +G+ +   +   W +  D +A A+
Sbjct: 114 AEVLGDDFTPEVKAAWDKLLDVIADAL 140


This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue. Length = 140

>gnl|CDD|215673 pfam00042, Globin, Globin Back     alignment and domain information
>gnl|CDD|237337 PRK13289, PRK13289, bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
cd01040140 globin Globins are heme proteins, which bind and t 99.97
PRK13289 399 bifunctional nitric oxide dioxygenase/dihydropteri 99.95
PF00042110 Globin: Globin plant globin signature erythrocruor 99.94
COG1017150 Hmp Hemoglobin-like flavoprotein [Energy productio 99.93
KOG3378 385 consensus Globins and related hemoproteins [Energy 99.88
cd01067117 globin_like superfamily containing globins and tru 99.75
cd01068147 sensor_globin Globin domain present in Globin-Coup 98.61
PF11563158 Protoglobin: Protoglobin; PDB: 2VEE_G 3QZZ_A 3R0G_ 98.51
cd00454116 Trunc_globin Truncated hemoglobins (trHbs) are a f 98.14
PF01152120 Bac_globin: Bacterial-like globin; InterPro: IPR00 97.62
COG2346133 Truncated hemoglobins [General function prediction 93.68
>cd01040 globin Globins are heme proteins, which bind and transport oxygen Back     alignment and domain information
Probab=99.97  E-value=2.4e-31  Score=185.48  Aligned_cols=136  Identities=27%  Similarity=0.451  Sum_probs=127.2

Q ss_pred             CHHHHHHHHHHHHHHHhcchhhh---hhhccccCCchhhcCccCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhcccCc
Q 037487            4 TEKQEALVNESWEILKEISHKIA---CVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREKGK   80 (151)
Q Consensus         4 t~~e~~~i~~SW~~v~~~~~~~~---y~~lF~~~P~~~~~F~~~~~~~~~l~~~~~~~~H~~~v~~~l~~~i~~l~~~~~   80 (151)
                      |+.|+++|++||+.+..+...+|   |.+||+.+|+++.+|+.++..+.++.+++.|+.|+.+++.+++.+|.++++++.
T Consensus         1 s~~~~~~l~~sw~~~~~~~~~~g~~~f~~lf~~~P~~~~~F~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~v~~l~~~~~   80 (140)
T cd01040           1 SAEEKKLVKASWAKLKADREEIGLEFYERLFKAHPETRALFSRFGGLSAALKGSPKFKAHGKRVLNALDEAIKNLDDLEA   80 (140)
T ss_pred             CHHHHHHHHHHHHHHHccHHhHHHHHHHHHHHHChhHHHHhHHhCCchHhHccCHHHHHHHHHHHHHHHHHHHhccChHH
Confidence            68999999999999998888888   999999999999999998665446789999999999999999999999988777


Q ss_pred             hhhHHHHHHHHHHHHhhCCCCCchHhHHHHHHHHHHHHHhcccChh-HHHHHHHHHHHHHHHH
Q 037487           81 VTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRD-MNCTWVEAYDQLAAAI  142 (151)
Q Consensus        81 l~~~~~~l~~Lg~~H~~~gv~~~~f~~~~~~ll~~l~~~lg~~~~~-~~~AW~~~~~~i~~~i  142 (151)
                      +   ...|++||++|.++|++++||+.|+++|+.++++.+|+.|++ ..+||.+++..|++.|
T Consensus        81 l---~~~l~~lg~~H~~~~v~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~aW~~~~~~i~~~~  140 (140)
T cd01040          81 L---KALLAKLGRKHAKRGVDPEHFKLFGEALLEVLAEVLGDDFTPEVKAAWDKLLDVIADAL  140 (140)
T ss_pred             H---HHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHhCCcCCHHHHHHHHHHHHHHHHhC
Confidence            6   888999999999999999999999999999999999999999 9999999999998764



This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.

>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information
>PF00042 Globin: Globin plant globin signature erythrocruorin family signature alpha hemoglobin signature myoglobin signature thalassemia Back     alignment and domain information
>COG1017 Hmp Hemoglobin-like flavoprotein [Energy production and conversion] Back     alignment and domain information
>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] Back     alignment and domain information
>cd01067 globin_like superfamily containing globins and truncated hemoglobins Back     alignment and domain information
>cd01068 sensor_globin Globin domain present in Globin-Coupled-Sensors (GCS) Back     alignment and domain information
>PF11563 Protoglobin: Protoglobin; PDB: 2VEE_G 3QZZ_A 3R0G_A 3QZX_A 2VEB_A 1OR6_A 1OR4_B 2W31_B Back     alignment and domain information
>cd00454 Trunc_globin Truncated hemoglobins (trHbs) are a family of oxygen-binding heme proteins found in cyanobacteria, eubacteria, unicellular eukaryotes, and plants Back     alignment and domain information
>PF01152 Bac_globin: Bacterial-like globin; InterPro: IPR001486 Globins are haem-containing proteins involved in binding and/or transporting oxygen Back     alignment and domain information
>COG2346 Truncated hemoglobins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
3qqq_A168 Crystal Structure Of Non-Symbiotic Plant Hemoglobin 8e-37
2gnv_A165 Crystal Structure Of Non-Symbiotic Plant Hemoglobin 7e-36
1d8u_A166 Crystal Structure Of Non-Symbiotic Plant Hemoglobin 8e-36
2gnw_A165 Crystal Structure Of Non-Symbiotic Plant Hemoglobin 1e-35
2oif_A162 The Crystal Structure Of Ferric Cyanide Bound Barle 5e-35
2r50_A165 The Crystal Structure Of Nonsymbiotic Corn Hemoglob 1e-34
3qqr_A162 Crystal Structure Of Parasponia Hemoglobin; Differe 2e-34
1gdi_A153 Crystal Structure Of Ferric Complexes Of The Yellow 6e-33
1fsl_A143 Ferric Soybean Leghemoglobin Complexed With Nicotin 3e-26
>pdb|3QQQ|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Trema Tomentosa Length = 168 Back     alignment and structure

Iteration: 1

Score = 149 bits (375), Expect = 8e-37, Method: Compositional matrix adjust. Identities = 77/141 (54%), Positives = 102/141 (72%), Gaps = 4/141 (2%) Query: 2 VFTEKQEALVNESWEILKEISHKIAC---VSSPQIAPAAKGMFSFLRDSDGIPQNNPKLK 58 VFTE+QEALV +SW ++K+ S ++ + +IAP+AK +FS+L+DS + NPKLK Sbjct: 15 VFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLK 74 Query: 59 AHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKE 118 HA+ VF MTCESA+QLR+ GKVTV ++ LK LG++H KNGV++ HFEV + ALL IKE Sbjct: 75 PHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKE 134 Query: 119 AVGEKWR-DMNCTWVEAYDQL 138 AV E W +M W EAYDQL Sbjct: 135 AVPEMWSPEMKNAWGEAYDQL 155
>pdb|2GNV|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Rice, B10 Mutant F40l Length = 165 Back     alignment and structure
>pdb|1D8U|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Rice Length = 166 Back     alignment and structure
>pdb|2GNW|A Chain A, Crystal Structure Of Non-Symbiotic Plant Hemoglobin From Rice, B10 Mutant F40w Length = 165 Back     alignment and structure
>pdb|2OIF|A Chain A, The Crystal Structure Of Ferric Cyanide Bound Barley Hexacoordinate Hemoglobin. Length = 162 Back     alignment and structure
>pdb|2R50|A Chain A, The Crystal Structure Of Nonsymbiotic Corn Hemoglobin 1 Length = 165 Back     alignment and structure
>pdb|3QQR|A Chain A, Crystal Structure Of Parasponia Hemoglobin; Differential Heme Coordination Is Linked To Quaternary Structure Length = 162 Back     alignment and structure
>pdb|1GDI|A Chain A, Crystal Structure Of Ferric Complexes Of The Yellow Lupin Leghemoglobin With Isoquinoline At 1.8 Angstroms Resolution (Russian) Length = 153 Back     alignment and structure
>pdb|1FSL|A Chain A, Ferric Soybean Leghemoglobin Complexed With Nicotinate Length = 143 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2oif_A162 Horvu GLB1, non-legume hemoglobin; hexacoordinate 2e-37
1gdj_A153 Leghemoglobin (deoxy); oxygen transport; HET: HEM; 8e-36
1bin_A143 Leghemoglobin A; heme, nitrogen fixation, multigen 3e-31
1q1f_A151 Neuroglobin; globin fold, heme protein, oxygen sto 2e-30
1sct_A150 Hemoglobin II (carbonmonoxy) (alpha chain); oxygen 9e-30
1hlb_A158 Hemoglobin (deoxy); oxygen transport; HET: HEM; 2. 1e-28
2c0k_A151 Hemoglobin; oxygen transport, heme, iron, metal-bi 3e-28
1x46_A150 Globin chain, hemoglobin component VII; diptera, m 2e-27
2zs0_A140 Extracellular giant hemoglobin major globin subun; 6e-27
1sct_B151 Hemoglobin II (carbonmonoxy) (beta chain); oxygen 1e-26
1eca_A136 Erythrocruorin (AQUO Met); oxygen transport; HET: 3e-26
1b0b_A142 Hemoglobin; hemoprotein, sulfide carrier, globins, 4e-26
2dc3_A193 Cytoglobin; myoglobin, heme, oxygen transport, oxy 5e-26
1jf3_A147 Monomer hemoglobin component III; oxygen storage/t 7e-26
1hlm_A159 Hemoglobin (cyano Met); oxygen transport; HET: HEM 9e-26
3pt8_B152 Hemoglobin III; oxygen carrier, oxygen transport; 3e-25
1x9f_B145 Erythrocruorin, globin II, extracellular, globin A 5e-25
3ubc_A131 Hemoglobin-like flavoprotein; oxygen-bound, autoxi 6e-25
3pt8_A152 Hemoglobin II; oxygen carrier, oxygen transport; H 1e-24
2bk9_A153 CG9734-PA; oxygen transport, drosophila melanogast 2e-24
1yhu_B144 Giant hemoglobins B chain; globin fold, oxygen sto 2e-24
1mba_A147 Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysi 2e-24
1x9f_D140 Globin C, hemoglobin chain D1, globin III, extrace 2e-24
2zs0_B142 Extracellular giant hemoglobin major globin subun; 4e-24
1yhu_A145 Hemoglobin A1 chain; globin fold, oxygen storage-t 1e-23
1ith_A141 Hemoglobin (cyano Met); oxygen transport; HET: HEM 2e-23
3g46_A146 Globin-1; oxygen transport, allostery, oxygen affi 3e-22
1x9f_C153 Erythrocruorin, globin III, extracellular, globin 4e-22
2zs0_C147 Extracellular giant hemoglobin major globin subun; 1e-21
2vhb_A146 Hemoglobin; heme, respiratory protein, oxygen tran 2e-21
1yhu_D149 Hemoglobin B2 chain; globin fold, oxygen storage-t 9e-21
1yhu_C148 Hemoglobin B1A chain; globin fold, oxygen storage- 1e-20
1x3k_A152 Hemoglobin component V; diptera, midge larva, oxyg 2e-20
2zs0_D145 Extracellular giant hemoglobin major globin subun; 1e-19
2wy4_A140 Single domain haemoglobin; heme, transport, oxygen 4e-19
1x9f_A151 Globin IV, extracellular; crystal, dodecamer, allo 4e-19
1out_B146 Hemoglobin I; heme, oxygen transport, respiratory 6e-19
1it2_A146 Hemoglobin; hagfish, deoxy form, oxygen storage/tr 1e-18
2w72_B146 Human hemoglobin A; iron, heme, glycation, transpo 1e-18
2lhb_A149 Hemoglobin V (cyano Met); oxygen transport; HET: H 2e-18
3d1k_A142 Hemoglobin subunit alpha-1; antarctic FISH hemoglo 4e-18
2aa1_B146 Hemoglobin beta-C chain; ROOT effect, cooperativit 5e-18
1lhs_A153 Myoglobin; oxygen storage; HET: HEM; 2.00A {Carett 1e-17
1cg5_B141 Protein (hemoglobin); oxygen transport; HET: HEM; 1e-17
1a6m_A151 Myoglobin; heme protein, model compounds, oxygen s 2e-17
1spg_A144 Hemoglobin; carbon monoxide, R-state, teleost FISH 8e-17
1jeb_A142 Hemoglobin zeta chain; oxygen transport, oxygen st 1e-16
3d1k_B146 Hemoglobin subunit beta-1/2; antarctic FISH hemogl 2e-16
2w72_C141 Human hemoglobin A; iron, heme, glycation, transpo 6e-16
1xq5_A143 Hemoglobin alpha-1 chain; FISH hemoglobin, rapid o 2e-15
1cg5_A141 Protein (hemoglobin); oxygen transport; HET: HEM; 2e-15
1wmu_A141 Hemoglobin D alpha chain; hemoglobin D, reptilia, 3e-15
1out_A143 Hemoglobin I; heme, oxygen transport, respiratory 7e-15
2nrl_A147 Myoglobin; transport protein; HET: HEM; 0.91A {Thu 2e-14
1v4x_B146 Hemoglobin beta chain; oxygen transport, heme, res 4e-14
2r80_B146 Hemoglobin subunit beta; oxygen tranport/storage, 1e-13
3bom_A143 Hemoglobin subunit alpha-4; FISH hemoglobin, struc 5e-13
3bom_B147 Hemoglobin subunit beta-4; FISH hemoglobin, struct 1e-12
1c7c_A283 Protein (deoxyhemoglobin (alpha chain)); heme, oxy 2e-11
1c7c_A 283 Protein (deoxyhemoglobin (alpha chain)); heme, oxy 7e-11
3mkb_A140 Hemoglobin subunit alpha; oxygen affinity, shortfi 3e-10
1tu9_A134 Hypothetical protein PA3967; structural genomics, 6e-10
3mvc_A161 Globin protein 6; oxygen sensor, heme-binding prot 3e-09
1h97_A147 Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitu 4e-09
2r80_A141 Hemoglobin subunit alpha-A; oxygen tranport/storag 4e-09
2vyw_A148 Hemoglobin; trematode, oxygen binding; HET: HEM; 1 4e-07
1gvh_A 396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 5e-06
3lb2_A137 Dehaloperoxidase A; globin, oxidoreductase; HET: H 1e-05
1cqx_A 403 Flavohemoprotein; globin fold, six-stranded antipa 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3mkb_B136 Hemoglobin subunit beta; oxygen affinity, shortfin 4e-04
>2oif_A Horvu GLB1, non-legume hemoglobin; hexacoordinate hemoglobin, barley, ligand binding, non- symbiotic, symbiotic, evolution; HET: HEM; 1.80A {Hordeum vulgare} PDB: 2r50_A* 1d8u_A* 2gnv_A* 2gnw_A* 3qqq_A* 3qqr_A* Length = 162 Back     alignment and structure
 Score =  124 bits (313), Expect = 2e-37
 Identities = 85/153 (55%), Positives = 105/153 (68%), Gaps = 5/153 (3%)

Query: 1   MVFTEKQEALVNESWEILKEISHKIACVSSPQI---APAAKGMFSFLRDSDGIPQNNPKL 57
           +VF+E++EALV +SW I+K+ S  +      +I   AP+A+ MF FLRDSD   + NPKL
Sbjct: 8   VVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSDVPLETNPKL 67

Query: 58  KAHAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIK 117
           K HAV VF MTCE+A QLR+ GK+TV +TTLK LG  HLK GV D HFEV + ALL  IK
Sbjct: 68  KTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHFEVTRFALLETIK 127

Query: 118 EAV-GEKW-RDMNCTWVEAYDQLAAAIKAEMKE 148
           EA+  + W  +M   W EAYDQL AAIK EMK 
Sbjct: 128 EALPADMWGPEMRNAWGEAYDQLVAAIKQEMKP 160


>1gdj_A Leghemoglobin (deoxy); oxygen transport; HET: HEM; 1.70A {Lupinus luteus} SCOP: a.1.1.2 PDB: 1gdi_A* 1gdk_A* 1gdl_A* 1lh1_A* 1lh2_A* 1lh3_A* 1lh5_A* 1lh6_A* 1lh7_A* 2gdm_A* 2lh1_A* 2lh2_A* 2lh3_A* 2lh5_A* 2lh6_A* 2lh7_A* Length = 153 Back     alignment and structure
>1bin_A Leghemoglobin A; heme, nitrogen fixation, multigene family, oxygen transport; HET: HEM; 2.20A {Glycine max} SCOP: a.1.1.2 PDB: 1fsl_A* Length = 143 Back     alignment and structure
>1q1f_A Neuroglobin; globin fold, heme protein, oxygen storage/transport complex; HET: HEM; 1.50A {Mus musculus} SCOP: a.1.1.2 PDB: 1w92_A* 3gk9_A* 2vry_A* 3gkt_A* 3gln_A* 1oj6_A* Length = 151 Back     alignment and structure
>1sct_A Hemoglobin II (carbonmonoxy) (alpha chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Length = 150 Back     alignment and structure
>1hlb_A Hemoglobin (deoxy); oxygen transport; HET: HEM; 2.50A {Caudina arenicola} SCOP: a.1.1.2 Length = 158 Back     alignment and structure
>2c0k_A Hemoglobin; oxygen transport, heme, iron, metal-binding; HET: HEM; 2.6A {Gasterophilus intestinalis} Length = 151 Back     alignment and structure
>1x46_A Globin chain, hemoglobin component VII; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.50A {Tokunagayusurika akamusi} Length = 150 Back     alignment and structure
>2zs0_A Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_A* 2d2m_A* 2zfo_A* 2zs1_A* Length = 140 Back     alignment and structure
>1sct_B Hemoglobin II (carbonmonoxy) (beta chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Length = 151 Back     alignment and structure
>1eca_A Erythrocruorin (AQUO Met); oxygen transport; HET: HEM; 1.40A {Chironomus thummi thummi} SCOP: a.1.1.2 PDB: 1ecd_A* 1ecn_A* 1eco_A* Length = 136 Back     alignment and structure
>1b0b_A Hemoglobin; hemoprotein, sulfide carrier, globins, oxygen transport, oxygen storage/transport complex; HET: HEM; 1.43A {Lucina pectinata} SCOP: a.1.1.2 PDB: 1ebt_A* 1flp_A* 1moh_A* Length = 142 Back     alignment and structure
>2dc3_A Cytoglobin; myoglobin, heme, oxygen transport, oxygen storage, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.68A {Homo sapiens} PDB: 1v5h_A* 3ag0_A* 1urv_A* 1umo_A* 1ury_A* 1ut0_A* 1ux9_A* Length = 193 Back     alignment and structure
>1jf3_A Monomer hemoglobin component III; oxygen storage/transport complex; HET: HEM; 1.40A {Glycera dibranchiata} SCOP: a.1.1.2 PDB: 1jl7_A* 1jf4_A* 1jl6_A* 1vre_A* 1vrf_A* 1hbg_A* 2hbg_A* Length = 147 Back     alignment and structure
>1hlm_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.90A {Caudina arenicola} SCOP: a.1.1.2 Length = 159 Back     alignment and structure
>3pt8_B Hemoglobin III; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} PDB: 3pt7_B* Length = 152 Back     alignment and structure
>1x9f_B Erythrocruorin, globin II, extracellular, globin AIII, globin B; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_B* Length = 145 Back     alignment and structure
>3ubc_A Hemoglobin-like flavoprotein; oxygen-bound, autoxidation, nanotemplate, langmuir-blodgett, films, oxygen transport; HET: HEM; 1.65A {Methylacidiphilum infernorum V4} PDB: 3ubv_A* 3s1i_A* 3s1j_A* Length = 131 Back     alignment and structure
>3pt8_A Hemoglobin II; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} PDB: 3pi1_A* 2olp_A* 3pi3_A* 3pi4_A* 3pt7_A* 3pi2_A* Length = 152 Back     alignment and structure
>2bk9_A CG9734-PA; oxygen transport, drosophila melanogaster hemoglobin, heme hexacoordination, insect hemoglobin, protein cavities; HET: HEM CXS; 1.2A {Drosophila melanogaster} PDB: 2g3h_A* Length = 153 Back     alignment and structure
>1yhu_B Giant hemoglobins B chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 144 Back     alignment and structure
>1mba_A Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysia limacina} SCOP: a.1.1.2 PDB: 2fal_A* 3mba_A* 4mba_A* 5mba_A* 2fam_A* 1dm1_A* Length = 147 Back     alignment and structure
>1x9f_D Globin C, hemoglobin chain D1, globin III, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_D* Length = 140 Back     alignment and structure
>2zs0_B Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_B* 2d2m_B* 2zfo_B* 2zs1_B* Length = 142 Back     alignment and structure
>1yhu_A Hemoglobin A1 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 145 Back     alignment and structure
>1ith_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.50A {Urechis caupo} SCOP: a.1.1.2 Length = 141 Back     alignment and structure
>3g46_A Globin-1; oxygen transport, allostery, oxygen affinity, cytoplasm, heme, iron, metal-binding, oxygen storage/transport, oxygen binding; HET: HEM; 0.91A {Scapharca inaequivalvis} PDB: 1nxf_A* 3g4q_A* 3g4r_A* 3g4u_A* 3g4v_A* 3g4w_A* 3g4y_A* 3g52_A* 3g53_A* 3uhg_A* 3uhs_A* 3uhk_A* 3uhi_A* 3uhn_A* 3ugy_A* 2auo_A* 2aup_A* 3uhr_A* 3uh5_A* 3uh3_A* ... Length = 146 Back     alignment and structure
>1x9f_C Erythrocruorin, globin III, extracellular, globin C; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_C* Length = 153 Back     alignment and structure
>2zs0_C Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_C* 2d2m_C* 2zfo_C* 2zs1_C* Length = 147 Back     alignment and structure
>2vhb_A Hemoglobin; heme, respiratory protein, oxygen transport; HET: HEM; 1.76A {Vitreoscilla stercoraria} SCOP: a.1.1.2 PDB: 1vhb_A* 3vhb_A* 4vhb_A* Length = 146 Back     alignment and structure
>1yhu_D Hemoglobin B2 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 149 Back     alignment and structure
>1yhu_C Hemoglobin B1A chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Length = 148 Back     alignment and structure
>1x3k_A Hemoglobin component V; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.64A {Tokunagayusurika akamusi} PDB: 2zwj_A* 3a5a_A* 3a5b_A* 3a5g_A* 3a9m_A* 3arj_A* 3ark_A* 3arl_A* Length = 152 Back     alignment and structure
>2zs0_D Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2zfo_D* 2zs1_D* 2d2m_D* 2d2n_D* Length = 145 Back     alignment and structure
>2wy4_A Single domain haemoglobin; heme, transport, oxygen transport; HET: HEM; 1.35A {Campylobacter jejuni} Length = 140 Back     alignment and structure
>1x9f_A Globin IV, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_A* Length = 151 Back     alignment and structure
>1out_B Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_B* Length = 146 Back     alignment and structure
>1it2_A Hemoglobin; hagfish, deoxy form, oxygen storage/transport complex; HET: HEM; 1.60A {Eptatretus burgeri} SCOP: a.1.1.2 PDB: 1it3_A* Length = 146 Back     alignment and structure
>2w72_B Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7w_B* 1qi8_B* 1j7y_B* 1dxu_B* 1a0u_B* 1a0z_B* 1gli_B* 1j7s_B* 1o1l_B* 1o1n_B* 1y0t_B* 1y0w_B* 1o1o_B* 1ye2_B* 1y35_B* 1y22_B* 1ye0_B* 1dxt_B* 1y5f_B* 1ird_B* ... Length = 146 Back     alignment and structure
>2lhb_A Hemoglobin V (cyano Met); oxygen transport; HET: HEM; 2.00A {Petromyzon marinus} SCOP: a.1.1.2 PDB: 3lhb_A* 1f5o_A* 1f5p_A* 1uc3_A* Length = 149 Back     alignment and structure
>3d1k_A Hemoglobin subunit alpha-1; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 2aa1_A* 1t1n_A* 1la6_A* 3nfe_A* 3ng6_A* 2h8f_A* 1pbx_A* 1s5x_A* 1s5y_A* 1hbh_A* 2h8d_A* 2peg_A* 3gkv_A* 3gqg_A* 1v4x_A* 1v4u_A* 1v4w_A* Length = 142 Back     alignment and structure
>2aa1_B Hemoglobin beta-C chain; ROOT effect, cooperativity, antarctic FISH, oxygen storage/transport complex; HET: HEM; 1.80A {Trematomus newnesi} SCOP: a.1.1.2 PDB: 1xq5_B* 3bj1_B* 3bj2_B* 3bj3_B* Length = 146 Back     alignment and structure
>1lhs_A Myoglobin; oxygen storage; HET: HEM; 2.00A {Caretta caretta} SCOP: a.1.1.2 PDB: 1lht_A* Length = 153 Back     alignment and structure
>1cg5_B Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_B* Length = 141 Back     alignment and structure
>1a6m_A Myoglobin; heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates, oxygen transpor; HET: HEM; 1.00A {Physeter catodon} SCOP: a.1.1.2 PDB: 1a6k_A* 1a6n_A* 2jho_A* 1ufp_A* 2eb9_A* 2eb8_A* 2w6w_A* 2ekt_A* 105m_A* 104m_A* 1ajh_A* 1ajg_A* 1bvc_A* 1bvd_A* 1bz6_A* 1bzr_A* 1cq2_A* 1duk_A* 1ebc_A* 1hjt_A* ... Length = 151 Back     alignment and structure
>1spg_A Hemoglobin; carbon monoxide, R-state, teleost FISH effect, oxygen transport; HET: HEM; 1.95A {Leiostomus xanthurus} SCOP: a.1.1.2 Length = 144 Back     alignment and structure
>1jeb_A Hemoglobin zeta chain; oxygen transport, oxygen storage/transport complex; HET: HEM; 2.10A {Homo sapiens} SCOP: a.1.1.2 Length = 142 Back     alignment and structure
>3d1k_B Hemoglobin subunit beta-1/2; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 1t1n_B* 1la6_B* 3nfe_B* 3ng6_B* 2h8f_B* 1pbx_B* 1s5x_B* 1s5y_B* 1hbh_B* 2h8d_B* 2peg_B* 3gkv_B* 3gqg_B* Length = 146 Back     alignment and structure
>2w72_C Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7s_A* 1qi8_A* 1j7y_A* 1o1i_A* 2w72_A* 1bzz_A* 1c7b_A* 1j7w_A* 1o1k_A* 1o1o_A* 1y0c_A* 1ydz_A* 3ia3_B* 1ird_A* 1a00_A* 1a0u_A* 1a0z_A* 1a3n_A* 1a9w_A* 1b86_A* ... Length = 141 Back     alignment and structure
>1xq5_A Hemoglobin alpha-1 chain; FISH hemoglobin, rapid oxidation, structural genomics, protein structure initiative, PSI, CESG; HET: HEM; 1.90A {Perca flavescens} SCOP: a.1.1.2 PDB: 3bj1_A* 3bj2_A* 3bj3_A* 3bcq_A* Length = 143 Back     alignment and structure
>1cg5_A Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_A* Length = 141 Back     alignment and structure
>1wmu_A Hemoglobin D alpha chain; hemoglobin D, reptilia, the aldabra giant tortoise, geochelone gigantea, oxygen storage/transport complex; HET: HEM; 1.65A {Dipsochelys dussumieri} SCOP: a.1.1.2 PDB: 1v75_A* 2z6n_A* 1hbr_A* Length = 141 Back     alignment and structure
>1out_A Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_A* Length = 143 Back     alignment and structure
>2nrl_A Myoglobin; transport protein; HET: HEM; 0.91A {Thunnus atlanticus} PDB: 2nx0_A* 3qm5_A* 3qm6_A* 3qm7_A* 3qm8_A* 3qm9_A* 3qma_A* 1myt_A* 2nrm_A* Length = 147 Back     alignment and structure
>1v4x_B Hemoglobin beta chain; oxygen transport, heme, respiratory protein, erythrocyte, ROOT effect, SWIM bladder, oxygen storage/transport complex; HET: HEM; 1.60A {Thunnus thynnus} SCOP: a.1.1.2 PDB: 1v4u_B* 1v4w_B* Length = 146 Back     alignment and structure
>2r80_B Hemoglobin subunit beta; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3dhr_B* 3mju_B* 1faw_B* 3k8b_B* 2qmb_B* 3eok_B* 1a4f_B* 1c40_B* 1hv4_B* 2zfb_B* 3mjp_B* 1hbr_B* 3fs4_B* 3a59_B* 1wmu_B* 1v75_B* 2z6n_B* 3at5_B* 3at6_B* Length = 146 Back     alignment and structure
>3bom_A Hemoglobin subunit alpha-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_A* Length = 143 Back     alignment and structure
>3bom_B Hemoglobin subunit beta-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_B* 3bcq_B* 1spg_B* Length = 147 Back     alignment and structure
>1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Length = 283 Back     alignment and structure
>1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Length = 283 Back     alignment and structure
>3mkb_A Hemoglobin subunit alpha; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} PDB: 1gcv_A* 1gcw_A* Length = 140 Back     alignment and structure
>1tu9_A Hypothetical protein PA3967; structural genomics, heme, hemoglobin, pseudomonas aeruginos PSI, protein structure initiative; HET: HEM; 1.20A {Pseudomonas aeruginosa} SCOP: a.1.1.2 Length = 134 Back     alignment and structure
>3mvc_A Globin protein 6; oxygen sensor, heme-binding protein, C. elegans, OXY transport, electron transport; HET: HEM; 1.40A {Caenorhabditis elegans} Length = 161 Back     alignment and structure
>1h97_A Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitum} SCOP: a.1.1.2 PDB: 1kfr_A* Length = 147 Back     alignment and structure
>2r80_A Hemoglobin subunit alpha-A; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3mju_A* 3dhr_A* 3mjp_A* 1faw_A* 3eok_A* 3k8b_A* 2qmb_A* 3fs4_A* 3a59_A* 1a4f_A* 1hv4_A* 2zfb_A* 1c40_A* 3at5_A* 3at6_A* Length = 141 Back     alignment and structure
>2vyw_A Hemoglobin; trematode, oxygen binding; HET: HEM; 1.8A {Fasciola hepatica} Length = 148 Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396 Back     alignment and structure
>3lb2_A Dehaloperoxidase A; globin, oxidoreductase; HET: HEM; 1.06A {Amphitrite ornata} PDB: 1ewa_A* 1ew6_A* 2qfk_A* 3kun_A* 3lb1_A* 3dr9_A* 3lb3_A* 3lb4_A* 3mou_A* 3ord_A* 3mym_A* 3k3u_A* 3o7n_A* 3kuo_A* 2qfn_A* 3myn_A* 3oj1_A* 3ok5_A* 3ixf_A* Length = 137 Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Length = 403 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkb_B Hemoglobin subunit beta; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
1out_A143 Hemoglobin I; heme, oxygen transport, respiratory 100.0
4b4y_A154 Neuroglobin; transport protein, nervous system evo 100.0
1gdj_A153 Leghemoglobin (deoxy); oxygen transport; HET: HEM; 100.0
3bom_A143 Hemoglobin subunit alpha-4; FISH hemoglobin, struc 100.0
1xq5_A143 Hemoglobin alpha-1 chain; FISH hemoglobin, rapid o 100.0
1spg_A144 Hemoglobin; carbon monoxide, R-state, teleost FISH 100.0
2c0k_A151 Hemoglobin; oxygen transport, heme, iron, metal-bi 100.0
3d1k_A142 Hemoglobin subunit alpha-1; antarctic FISH hemoglo 100.0
1cg5_B141 Protein (hemoglobin); oxygen transport; HET: HEM; 100.0
1jeb_A142 Hemoglobin zeta chain; oxygen transport, oxygen st 100.0
2dc3_A193 Cytoglobin; myoglobin, heme, oxygen transport, oxy 100.0
2bk9_A153 CG9734-PA; oxygen transport, drosophila melanogast 100.0
1x46_A150 Globin chain, hemoglobin component VII; diptera, m 100.0
3pt8_B152 Hemoglobin III; oxygen carrier, oxygen transport; 100.0
1cg5_A141 Protein (hemoglobin); oxygen transport; HET: HEM; 100.0
3d1k_B146 Hemoglobin subunit beta-1/2; antarctic FISH hemogl 100.0
2r80_A141 Hemoglobin subunit alpha-A; oxygen tranport/storag 100.0
1a6m_A151 Myoglobin; heme protein, model compounds, oxygen s 100.0
3pt8_A152 Hemoglobin II; oxygen carrier, oxygen transport; H 100.0
1hlb_A158 Hemoglobin (deoxy); oxygen transport; HET: HEM; 2. 100.0
4hrt_A150 Globin-2 A chain; oxygen transport, globin fold, o 100.0
1wmu_A141 Hemoglobin D alpha chain; hemoglobin D, reptilia, 100.0
2aa1_B146 Hemoglobin beta-C chain; ROOT effect, cooperativit 100.0
2oif_A162 Horvu GLB1, non-legume hemoglobin; hexacoordinate 100.0
1lhs_A153 Myoglobin; oxygen storage; HET: HEM; 2.00A {Carett 100.0
1v4x_B146 Hemoglobin beta chain; oxygen transport, heme, res 100.0
2r80_B146 Hemoglobin subunit beta; oxygen tranport/storage, 100.0
2w72_B146 Human hemoglobin A; iron, heme, glycation, transpo 100.0
4hrt_B152 Hemoglobin B chain; oxygen transport, globin fold, 100.0
1q1f_A151 Neuroglobin; globin fold, heme protein, oxygen sto 100.0
3mkb_A140 Hemoglobin subunit alpha; oxygen affinity, shortfi 100.0
3bom_B147 Hemoglobin subunit beta-4; FISH hemoglobin, struct 100.0
1hlm_A159 Hemoglobin (cyano Met); oxygen transport; HET: HEM 100.0
1sct_A150 Hemoglobin II (carbonmonoxy) (alpha chain); oxygen 100.0
2w72_C141 Human hemoglobin A; iron, heme, glycation, transpo 100.0
1mba_A147 Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysi 100.0
1sct_B151 Hemoglobin II (carbonmonoxy) (beta chain); oxygen 100.0
1yhu_A145 Hemoglobin A1 chain; globin fold, oxygen storage-t 100.0
1jf3_A147 Monomer hemoglobin component III; oxygen storage/t 100.0
1out_B146 Hemoglobin I; heme, oxygen transport, respiratory 100.0
1x9f_B145 Erythrocruorin, globin II, extracellular, globin A 100.0
1x3k_A152 Hemoglobin component V; diptera, midge larva, oxyg 100.0
1ith_A141 Hemoglobin (cyano Met); oxygen transport; HET: HEM 100.0
1x9f_D140 Globin C, hemoglobin chain D1, globin III, extrace 100.0
1x9f_C153 Erythrocruorin, globin III, extracellular, globin 100.0
1bin_A143 Leghemoglobin A; heme, nitrogen fixation, multigen 100.0
3mkb_B136 Hemoglobin subunit beta; oxygen affinity, shortfin 100.0
1yhu_D149 Hemoglobin B2 chain; globin fold, oxygen storage-t 100.0
1gcv_B136 Hemoglobin; oxygen storage/transport complex; HET: 100.0
2zs0_B142 Extracellular giant hemoglobin major globin subun; 100.0
1x9f_A151 Globin IV, extracellular; crystal, dodecamer, allo 100.0
2zs0_A140 Extracellular giant hemoglobin major globin subun; 100.0
1yhu_C148 Hemoglobin B1A chain; globin fold, oxygen storage- 100.0
3g46_A146 Globin-1; oxygen transport, allostery, oxygen affi 100.0
1b0b_A142 Hemoglobin; hemoprotein, sulfide carrier, globins, 100.0
3ubc_A131 Hemoglobin-like flavoprotein; oxygen-bound, autoxi 100.0
2zs0_C147 Extracellular giant hemoglobin major globin subun; 100.0
3mvc_A161 Globin protein 6; oxygen sensor, heme-binding prot 100.0
1yhu_B144 Giant hemoglobins B chain; globin fold, oxygen sto 100.0
1it2_A146 Hemoglobin; hagfish, deoxy form, oxygen storage/tr 100.0
2lhb_A149 Hemoglobin V (cyano Met); oxygen transport; HET: H 100.0
2zs0_D145 Extracellular giant hemoglobin major globin subun; 100.0
2nrl_A147 Myoglobin; transport protein; HET: HEM; 0.91A {Thu 100.0
1c7c_A283 Protein (deoxyhemoglobin (alpha chain)); heme, oxy 100.0
1eca_A136 Erythrocruorin (AQUO Met); oxygen transport; HET: 100.0
1h97_A147 Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitu 100.0
2wtg_A159 Globin-like protein; metal-binding, oxygen transpo 100.0
1c7c_A 283 Protein (deoxyhemoglobin (alpha chain)); heme, oxy 100.0
2vyw_A148 Hemoglobin; trematode, oxygen binding; HET: HEM; 1 100.0
2vhb_A146 Hemoglobin; heme, respiratory protein, oxygen tran 100.0
3lb2_A137 Dehaloperoxidase A; globin, oxidoreductase; HET: H 99.97
2wy4_A140 Single domain haemoglobin; heme, transport, oxygen 99.97
1tu9_A134 Hypothetical protein PA3967; structural genomics, 99.97
1cqx_A 403 Flavohemoprotein; globin fold, six-stranded antipa 99.95
4g1v_A 399 Flavohemoglobin; three domains: globin fold, antip 99.95
1gvh_A 396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 99.94
1ash_A150 Hemoglobin (OXY); oxygen storage; HET: HEM; 2.15A 99.93
2xki_A110 Neural hemoglobin; oxygen storage, metal-binding; 99.9
2w31_A162 Globin; oxygen transport, hexacoordination; HET: H 99.6
1or4_A178 Heme-based aerotactic transducer hemat; globin fol 99.08
1s69_A124 Cyanoglobin, hemoglobin, HB; on 2 helical fold, he 98.89
2bmm_A123 Thermostable hemoglobin from thermobifida fusca; b 98.66
1ux8_A132 YJBI protein; oxygen storage/transport, truncated 98.45
2gkm_A136 TRHBN, hemoglobin-like protein HBN, flavohemoglobi 98.41
2bkm_A128 Truncated hemoglobin from geobacillus stearothermo 98.37
2qrw_A128 Hemoglobin-like protein HBO; truncated hemoglobin 98.36
1dlw_A116 Hemoglobin; oxygen storage/transport complex; HET: 98.21
3aq9_A121 Group 1 truncated hemoglobin; 2/2 fold hemoglobin, 97.94
2veb_A195 Protoglobin; hemoprotein structure, protein matrix 97.94
1dly_A164 Hemoglobin; oxygen storage/transport complex; HET: 97.82
2ksc_A123 Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TR 97.31
2ig3_A127 Group III truncated haemoglobin; truncated hemoglo 96.63
2xyk_A133 2-ON-2 hemoglobin; oxygen storage-transport comple 96.34
>1out_A Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-38  Score=222.33  Aligned_cols=138  Identities=13%  Similarity=0.169  Sum_probs=130.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHhcchhhh---hhhccccCCchhhcCccCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhcc
Q 037487            1 MVFTEKQEALVNESWEILKEISHKIA---CVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLRE   77 (151)
Q Consensus         1 m~Lt~~e~~~i~~SW~~v~~~~~~~~---y~~lF~~~P~~~~~F~~~~~~~~~l~~~~~~~~H~~~v~~~l~~~i~~l~~   77 (151)
                      |.||++|+++|++||+.+..+.+.+|   |.|||+.+|+++++|+.|++.+   .+||++++|+.+|+++|+.+|.+|++
T Consensus         1 m~lt~~~~~~V~~sw~~v~~~~~~~g~~~~~rlF~~~P~~k~~F~~f~~~~---~~~~~~~~h~~~v~~al~~~v~~ld~   77 (143)
T 1out_A            1 XSLTAKDKSVVKAFWGKISGKADVVGAEALGRMLTAYPQTKTYFSHWADLS---PGSGPVKKHGGIIMGAIGKAVGLMDD   77 (143)
T ss_dssp             -CCCHHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHSGGGGGGGTTSSCCS---TTCHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             CCCCHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHCccHHHHHHHcCCCC---CCCHHHHHHHHHHHHHHHHHHHhHHh
Confidence            78999999999999999999999998   9999999999999999998765   58999999999999999999888877


Q ss_pred             cCchhhHHHHHHHHHHHHhh-CCCCCchHhHHHHHHHHHHHHHhcccChh-HHHHHHHHHHHHHHHHHHhhc
Q 037487           78 KGKVTVADTTLKYLGSVHLK-NGVLDPHFEVVKEALLRAIKEAVGEKWRD-MNCTWVEAYDQLAAAIKAEMK  147 (151)
Q Consensus        78 ~~~l~~~~~~l~~Lg~~H~~-~gv~~~~f~~~~~~ll~~l~~~lg~~~~~-~~~AW~~~~~~i~~~i~~~~~  147 (151)
                         +   .+.|.+||++|.. +||+|+||+.+++||+.+|++.+|++||+ +++||.++|+.|++.|+.+|.
T Consensus        78 ---l---~~~l~~L~~~H~~~~~V~p~~f~~~~~~Ll~~l~~~lg~~~t~e~~~AW~k~~~~va~~l~~~y~  143 (143)
T 1out_A           78 ---L---VGGMSALSDLHAFKLRVDPGNFKILSHNILVTLAIHFPSDFTPEVHIAVDKFLAAVSAALADKYR  143 (143)
T ss_dssp             ---H---HHHTHHHHHHHHHTTCCCTHHHHHHHHHHHHHHHHHCTTTCCHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             ---H---HHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHccccCCHHHHHHHHHHHHHHHHHHHhhcC
Confidence               5   7889999999998 99999999999999999999999999999 999999999999999998774



>4b4y_A Neuroglobin; transport protein, nervous system evolution, globin evolutio cnidarian, metazoan; HET: HEM; 2.30A {Symsagittifera roscoffensis} Back     alignment and structure
>1gdj_A Leghemoglobin (deoxy); oxygen transport; HET: HEM; 1.70A {Lupinus luteus} SCOP: a.1.1.2 PDB: 1gdi_A* 1gdk_A* 1gdl_A* 1lh1_A* 1lh2_A* 1lh3_A* 1lh5_A* 1lh6_A* 1lh7_A* 2gdm_A* 2lh1_A* 2lh2_A* 2lh3_A* 2lh5_A* 2lh6_A* 2lh7_A* Back     alignment and structure
>3bom_A Hemoglobin subunit alpha-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_A* Back     alignment and structure
>1xq5_A Hemoglobin alpha-1 chain; FISH hemoglobin, rapid oxidation, structural genomics, protein structure initiative, PSI, CESG; HET: HEM; 1.90A {Perca flavescens} SCOP: a.1.1.2 PDB: 3bj1_A* 3bj2_A* 3bj3_A* 3bcq_A* Back     alignment and structure
>1spg_A Hemoglobin; carbon monoxide, R-state, teleost FISH effect, oxygen transport; HET: HEM; 1.95A {Leiostomus xanthurus} SCOP: a.1.1.2 Back     alignment and structure
>2c0k_A Hemoglobin; oxygen transport, heme, iron, metal-binding; HET: HEM; 2.6A {Gasterophilus intestinalis} Back     alignment and structure
>3d1k_A Hemoglobin subunit alpha-1; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 2aa1_A* 1t1n_A* 1la6_A* 3nfe_A* 3ng6_A* 2h8f_A* 1pbx_A* 1s5x_A* 1s5y_A* 1hbh_A* 2h8d_A* 2peg_A* 3gkv_A* 3gqg_A* 1v4x_A* 1v4u_A* 1v4w_A* Back     alignment and structure
>1cg5_B Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_B* Back     alignment and structure
>1jeb_A Hemoglobin zeta chain; oxygen transport, oxygen storage/transport complex; HET: HEM; 2.10A {Homo sapiens} SCOP: a.1.1.2 Back     alignment and structure
>2dc3_A Cytoglobin; myoglobin, heme, oxygen transport, oxygen storage, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.68A {Homo sapiens} PDB: 1v5h_A* 3ag0_A* 1urv_A* 1umo_A* 1ury_A* 1ut0_A* 1ux9_A* Back     alignment and structure
>2bk9_A CG9734-PA; oxygen transport, drosophila melanogaster hemoglobin, heme hexacoordination, insect hemoglobin, protein cavities; HET: HEM CXS; 1.2A {Drosophila melanogaster} PDB: 2g3h_A* Back     alignment and structure
>1x46_A Globin chain, hemoglobin component VII; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.50A {Tokunagayusurika akamusi} Back     alignment and structure
>3pt8_B Hemoglobin III; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} PDB: 3pt7_B* Back     alignment and structure
>1cg5_A Protein (hemoglobin); oxygen transport; HET: HEM; 1.60A {Dasyatis akajei} SCOP: a.1.1.2 PDB: 1cg8_A* Back     alignment and structure
>3d1k_B Hemoglobin subunit beta-1/2; antarctic FISH hemoglobin, intermediate R/T quaternary structure, oxidation pathway, heme, iron, metal-binding; HET: HEM; 1.25A {Dusky notothen} SCOP: a.1.1.2 PDB: 1t1n_B* 1la6_B* 3nfe_B* 3ng6_B* 2h8f_B* 1pbx_B* 1s5x_B* 1s5y_B* 1hbh_B* 2h8d_B* 2peg_B* 3gkv_B* 3gqg_B* Back     alignment and structure
>2r80_A Hemoglobin subunit alpha-A; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3mju_A* 3dhr_A* 3mjp_A* 1faw_A* 3eok_A* 3k8b_A* 2qmb_A* 3fs4_A* 3a59_A* 1a4f_A* 1hv4_A* 2zfb_A* 1c40_A* 3at5_A* 3at6_A* Back     alignment and structure
>1a6m_A Myoglobin; heme protein, model compounds, oxygen storage, ligand binding geometry, conformational substates, oxygen transpor; HET: HEM; 1.00A {Physeter catodon} SCOP: a.1.1.2 PDB: 1a6k_A* 1a6n_A* 2jho_A* 1ufp_A* 2eb9_A* 2eb8_A* 2w6w_A* 2ekt_A* 105m_A* 104m_A* 1ajh_A* 1ajg_A* 1bvc_A* 1bvd_A* 1bz6_A* 1bzr_A* 1cq2_A* 1duk_A* 1ebc_A* 1hjt_A* ... Back     alignment and structure
>3pt8_A Hemoglobin II; oxygen carrier, oxygen transport; HET: HEM; 1.76A {Lucina pectinata} SCOP: a.1.1.0 PDB: 3pi1_A* 2olp_A* 3pi3_A* 3pi4_A* 3pt7_A* 3pi2_A* Back     alignment and structure
>1hlb_A Hemoglobin (deoxy); oxygen transport; HET: HEM; 2.50A {Caudina arenicola} SCOP: a.1.1.2 Back     alignment and structure
>4hrt_A Globin-2 A chain; oxygen transport, globin fold, oxygen; HET: HEM; 1.46A {Scapharca inaequivalvis} PDB: 1sct_A* Back     alignment and structure
>1wmu_A Hemoglobin D alpha chain; hemoglobin D, reptilia, the aldabra giant tortoise, geochelone gigantea, oxygen storage/transport complex; HET: HEM; 1.65A {Dipsochelys dussumieri} SCOP: a.1.1.2 PDB: 1v75_A* 2z6n_A* 1hbr_A* Back     alignment and structure
>2aa1_B Hemoglobin beta-C chain; ROOT effect, cooperativity, antarctic FISH, oxygen storage/transport complex; HET: HEM; 1.80A {Trematomus newnesi} SCOP: a.1.1.2 PDB: 1xq5_B* 3bj1_B* 3bj2_B* 3bj3_B* Back     alignment and structure
>2oif_A Horvu GLB1, non-legume hemoglobin; hexacoordinate hemoglobin, barley, ligand binding, non- symbiotic, symbiotic, evolution; HET: HEM; 1.80A {Hordeum vulgare} PDB: 2r50_A* 1d8u_A* 2gnv_A* 2gnw_A* 3qqq_A* 3qqr_A* Back     alignment and structure
>1lhs_A Myoglobin; oxygen storage; HET: HEM; 2.00A {Caretta caretta} SCOP: a.1.1.2 PDB: 1lht_A* Back     alignment and structure
>1v4x_B Hemoglobin beta chain; oxygen transport, heme, respiratory protein, erythrocyte, ROOT effect, SWIM bladder, oxygen storage/transport complex; HET: HEM; 1.60A {Thunnus thynnus} SCOP: a.1.1.2 PDB: 1v4u_B* 1v4w_B* Back     alignment and structure
>2r80_B Hemoglobin subunit beta; oxygen tranport/storage, heme, iron, metal-binding, oxygen transport, transport, oxygen binding; HET: HEM; 1.44A {Columba livia} PDB: 3dhr_B* 3mju_B* 1faw_B* 3k8b_B* 2qmb_B* 3eok_B* 1a4f_B* 1c40_B* 1hv4_B* 2zfb_B* 3mjp_B* 1hbr_B* 3fs4_B* 3a59_B* 1wmu_B* 1v75_B* 2z6n_B* 3at5_B* 3at6_B* Back     alignment and structure
>2w72_B Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7w_B* 1qi8_B* 1j7y_B* 1dxu_B* 1a0u_B* 1a0z_B* 1gli_B* 1j7s_B* 1o1l_B* 1o1n_B* 1y0t_B* 1y0w_B* 1o1o_B* 1ye2_B* 1y35_B* 1y22_B* 1ye0_B* 1dxt_B* 1y5f_B* 1ird_B* ... Back     alignment and structure
>4hrt_B Hemoglobin B chain; oxygen transport, globin fold, oxygen; HET: HEM; 1.46A {Scapharca inaequivalvis} PDB: 1sct_B* Back     alignment and structure
>1q1f_A Neuroglobin; globin fold, heme protein, oxygen storage/transport complex; HET: HEM; 1.50A {Mus musculus} SCOP: a.1.1.2 PDB: 1w92_A* 3gk9_A* 2vry_A* 3gkt_A* 3gln_A* 1oj6_A* Back     alignment and structure
>3mkb_A Hemoglobin subunit alpha; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} SCOP: a.1.1.2 PDB: 1gcv_A* 1gcw_A* Back     alignment and structure
>3bom_B Hemoglobin subunit beta-4; FISH hemoglobin, structural genomics community request, protein structure initiative, PSI-2; HET: HEM; 1.35A {Oncorhynchus mykiss} PDB: 2r1h_B* 3bcq_B* 1spg_B* Back     alignment and structure
>1hlm_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.90A {Caudina arenicola} SCOP: a.1.1.2 Back     alignment and structure
>1sct_A Hemoglobin II (carbonmonoxy) (alpha chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Back     alignment and structure
>2w72_C Human hemoglobin A; iron, heme, glycation, transport, acetylation, phosphoprotein, packing defects, disease mutation, distal site point mutation; HET: HEM SO4; 1.07A {Homo sapiens} PDB: 1j7s_A* 1qi8_A* 1j7y_A* 1o1i_A* 2w72_A* 1bzz_A* 1c7b_A* 1j7w_A* 1o1k_A* 1o1o_A* 1y0c_A* 1ydz_A* 3ia3_B* 1ird_A* 1a00_A* 1a0u_A* 1a0z_A* 1a3n_A* 1a9w_A* 1b86_A* ... Back     alignment and structure
>1mba_A Myoglobin; oxygen storage; HET: HEM; 1.60A {Aplysia limacina} SCOP: a.1.1.2 PDB: 2fal_A* 3mba_A* 4mba_A* 5mba_A* 2fam_A* 1dm1_A* Back     alignment and structure
>1sct_B Hemoglobin II (carbonmonoxy) (beta chain); oxygen transport; HET: HEM; 2.00A {Scapharca inaequivalvis} SCOP: a.1.1.2 Back     alignment and structure
>1yhu_A Hemoglobin A1 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>1jf3_A Monomer hemoglobin component III; oxygen storage/transport complex; HET: HEM; 1.40A {Glycera dibranchiata} SCOP: a.1.1.2 PDB: 1jl7_A* 1jf4_A* 1jl6_A* 1vre_A* 1vrf_A* 1hbg_A* 2hbg_A* Back     alignment and structure
>1out_B Hemoglobin I; heme, oxygen transport, respiratory protein, erythrocyte; HET: HEM; 2.30A {Oncorhynchus mykiss} SCOP: a.1.1.2 PDB: 1ouu_B* Back     alignment and structure
>1x9f_B Erythrocruorin, globin II, extracellular, globin AIII, globin B; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_B* Back     alignment and structure
>1x3k_A Hemoglobin component V; diptera, midge larva, oxygen storage/transport complex; HET: HEM; 1.64A {Tokunagayusurika akamusi} PDB: 2zwj_A* 3a5a_A* 3a5b_A* 3a5g_A* 3a9m_A* 3arj_A* 3ark_A* 3arl_A* Back     alignment and structure
>1ith_A Hemoglobin (cyano Met); oxygen transport; HET: HEM; 2.50A {Urechis caupo} SCOP: a.1.1.2 Back     alignment and structure
>1x9f_D Globin C, hemoglobin chain D1, globin III, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_D* Back     alignment and structure
>1x9f_C Erythrocruorin, globin III, extracellular, globin C; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_C* Back     alignment and structure
>1bin_A Leghemoglobin A; heme, nitrogen fixation, multigene family, oxygen transport; HET: HEM; 2.20A {Glycine max} SCOP: a.1.1.2 PDB: 1fsl_A* Back     alignment and structure
>3mkb_B Hemoglobin subunit beta; oxygen affinity, shortfin MAK storage, oxygen transport; HET: HEM; 1.90A {Isurus oxyrinchus} SCOP: a.1.1.2 Back     alignment and structure
>1yhu_D Hemoglobin B2 chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>1gcv_B Hemoglobin; oxygen storage/transport complex; HET: HEM; 2.00A {Mustelus griseus} SCOP: a.1.1.2 PDB: 1gcw_B* Back     alignment and structure
>2zs0_B Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_B* 2d2m_B* 2zfo_B* 2zs1_B* Back     alignment and structure
>1x9f_A Globin IV, extracellular; crystal, dodecamer, allosteric, oxygen storage/transport complex; HET: HEM; 2.60A {Lumbricus terrestris} SCOP: a.1.1.2 PDB: 2gtl_A* Back     alignment and structure
>2zs0_A Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_A* 2d2m_A* 2zfo_A* 2zs1_A* Back     alignment and structure
>1yhu_C Hemoglobin B1A chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>3g46_A Globin-1; oxygen transport, allostery, oxygen affinity, cytoplasm, heme, iron, metal-binding, oxygen storage/transport, oxygen binding; HET: HEM; 0.91A {Scapharca inaequivalvis} SCOP: a.1.1.2 PDB: 1nxf_A* 3g4q_A* 3g4r_A* 3g4u_A* 3g4v_A* 3g4w_A* 3g4y_A* 3g52_A* 3g53_A* 3uhg_A* 3uhs_A* 3uhk_A* 3uhi_A* 3uhn_A* 3ugy_A* 2auo_A* 2aup_A* 3uhr_A* 3uh5_A* 3uh3_A* ... Back     alignment and structure
>1b0b_A Hemoglobin; hemoprotein, sulfide carrier, globins, oxygen transport, oxygen storage/transport complex; HET: HEM; 1.43A {Lucina pectinata} SCOP: a.1.1.2 PDB: 1ebt_A* 1flp_A* 1moh_A* Back     alignment and structure
>3ubc_A Hemoglobin-like flavoprotein; oxygen-bound, autoxidation, nanotemplate, langmuir-blodgett, films, oxygen transport; HET: HEM; 1.65A {Methylacidiphilum infernorum V4} PDB: 3ubv_A* 3s1i_A* 3s1j_A* Back     alignment and structure
>2zs0_C Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2d2n_C* 2d2m_C* 2zfo_C* 2zs1_C* Back     alignment and structure
>3mvc_A Globin protein 6; oxygen sensor, heme-binding protein, C. elegans, OXY transport, electron transport; HET: HEM; 1.40A {Caenorhabditis elegans} Back     alignment and structure
>1yhu_B Giant hemoglobins B chain; globin fold, oxygen storage-transport complex; HET: HEM; 3.15A {Riftia pachyptila} Back     alignment and structure
>1it2_A Hemoglobin; hagfish, deoxy form, oxygen storage/transport complex; HET: HEM; 1.60A {Eptatretus burgeri} SCOP: a.1.1.2 PDB: 1it3_A* Back     alignment and structure
>2lhb_A Hemoglobin V (cyano Met); oxygen transport; HET: HEM; 2.00A {Petromyzon marinus} SCOP: a.1.1.2 PDB: 3lhb_A* 1f5o_A* 1f5p_A* 1uc3_A* Back     alignment and structure
>2zs0_D Extracellular giant hemoglobin major globin subun; annelida, magnesium, cooperativity, heme, iron, binding, oxygen transport, secreted; HET: HEM; 1.60A {Oligobrachia mashikoi} PDB: 2zfo_D* 2zs1_D* 2d2m_D* 2d2n_D* Back     alignment and structure
>2nrl_A Myoglobin; transport protein; HET: HEM; 0.91A {Thunnus atlanticus} PDB: 2nx0_A* 3qm5_A* 3qm6_A* 3qm7_A* 3qm8_A* 3qm9_A* 3qma_A* 1myt_A* 2nrm_A* Back     alignment and structure
>1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Back     alignment and structure
>1eca_A Erythrocruorin (AQUO Met); oxygen transport; HET: HEM; 1.40A {Chironomus thummi thummi} SCOP: a.1.1.2 PDB: 1ecd_A* 1ecn_A* 1eco_A* Back     alignment and structure
>1h97_A Globin-3; HET: HEM; 1.17A {Paramphistomum epiclitum} SCOP: a.1.1.2 PDB: 1kfr_A* Back     alignment and structure
>2wtg_A Globin-like protein; metal-binding, oxygen transport; HET: HEM; 1.50A {Caenorhabditis elegans} PDB: 2wth_A* Back     alignment and structure
>1c7c_A Protein (deoxyhemoglobin (alpha chain)); heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex; HET: HEM; 1.80A {Homo sapiens} SCOP: a.1.1.2 a.1.1.2 PDB: 1aby_A* 1abw_A* 1o1p_A* 1c7d_A* 1o1j_A* 1o1l_A* 1o1n_A* 1o1m_A* Back     alignment and structure
>2vyw_A Hemoglobin; trematode, oxygen binding; HET: HEM; 1.8A {Fasciola hepatica} Back     alignment and structure
>2vhb_A Hemoglobin; heme, respiratory protein, oxygen transport; HET: HEM; 1.76A {Vitreoscilla stercoraria} SCOP: a.1.1.2 PDB: 1vhb_A* 3vhb_A* 4vhb_A* Back     alignment and structure
>3lb2_A Dehaloperoxidase A; globin, oxidoreductase; HET: HEM; 1.06A {Amphitrite ornata} SCOP: a.1.1.2 PDB: 1ewa_A* 1ew6_A* 2qfk_A* 3kun_A* 3lb1_A* 3dr9_A* 3lb3_A* 3lb4_A* 3mou_A* 3ord_A* 3mym_A* 3k3u_A* 3o7n_A* 3kuo_A* 2qfn_A* 3myn_A* 3oj1_A* 3ok5_A* 3ixf_A* Back     alignment and structure
>2wy4_A Single domain haemoglobin; heme, transport, oxygen transport; HET: HEM; 1.35A {Campylobacter jejuni} Back     alignment and structure
>1tu9_A Hypothetical protein PA3967; structural genomics, heme, hemoglobin, pseudomonas aeruginos PSI, protein structure initiative; HET: HEM; 1.20A {Pseudomonas aeruginosa} SCOP: a.1.1.2 Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Back     alignment and structure
>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Back     alignment and structure
>1ash_A Hemoglobin (OXY); oxygen storage; HET: HEM; 2.15A {Ascaris suum} SCOP: a.1.1.2 Back     alignment and structure
>2xki_A Neural hemoglobin; oxygen storage, metal-binding; HET: HEM SO4; 1.30A {Cerebratulus lacteus} PDB: 1kr7_A* 1v07_A* 2xkg_A* 2xkh_A* 2vyz_A* 2vyy_A* Back     alignment and structure
>2w31_A Globin; oxygen transport, hexacoordination; HET: HEM; 1.50A {Geobacter sulfurreducens} Back     alignment and structure
>1or4_A Heme-based aerotactic transducer hemat; globin fold, signaling protein; HET: HEM; 2.15A {Bacillus subtilis} SCOP: a.1.1.2 PDB: 1or6_A* Back     alignment and structure
>1s69_A Cyanoglobin, hemoglobin, HB; on 2 helical fold, heme, iron, cyanoba oxygen binding, hexacoordinate, truncated, oxygen storage-T complex; HET: FLC HEM; 1.68A {Synechocystis SP} SCOP: a.1.1.1 PDB: 1s6a_A* 1mwb_A* 1rtx_A* 2hz1_A* 2hz3_A* 2hz2_A* Back     alignment and structure
>2bmm_A Thermostable hemoglobin from thermobifida fusca; bacterial hemoglobin, thermostable protein, oxygen storage/transport; HET: HEM; 2.48A {Thermobifida fusca} Back     alignment and structure
>1ux8_A YJBI protein; oxygen storage/transport, truncated hemoglobin, oxygen transport; HET: HEM; 2.15A {Bacillus subtilis} SCOP: a.1.1.1 Back     alignment and structure
>2gkm_A TRHBN, hemoglobin-like protein HBN, flavohemoglobin; truncated hemoglobin, mutant, oxygen storage/transport complex; HET: HEM; 1.73A {Mycobacterium tuberculosis} PDB: 1idr_A* 1rte_A* 1s56_A* 1s61_A* 2gl3_A* 2gln_A* 2gkn_A* Back     alignment and structure
>2bkm_A Truncated hemoglobin from geobacillus stearothermophilus; hypothetical protein, oxygen transport, transport, oxygen storage; HET: HEM; 1.5A {Geobacillus stearothermophilus} Back     alignment and structure
>2qrw_A Hemoglobin-like protein HBO; truncated hemoglobin fold, alpha helix, heme, hydroxylation, iron, membrane, metal-binding; HET: HEM; 1.93A {Mycobacterium tuberculosis} PDB: 1ngk_A* Back     alignment and structure
>1dlw_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.54A {Paramecium caudatum} SCOP: a.1.1.1 PDB: 1uvy_A* Back     alignment and structure
>3aq9_A Group 1 truncated hemoglobin; 2/2 fold hemoglobin, nitric oxide detoxification, oxygen BIN; HET: HEM; 1.74A {Tetrahymena pyriformis} PDB: 3aq5_A* 3aq6_A* 3aq8_A* 3aq7_A* Back     alignment and structure
>2veb_A Protoglobin; hemoprotein structure, protein matrix tunnels, methanogenesis, archaea protein, transport protein; HET: HEM; 1.30A {Methanosarcina acetivorans} PDB: 2vee_A* 3r0g_A* 3qzz_A* 3qzx_A* Back     alignment and structure
>1dly_A Hemoglobin; oxygen storage/transport complex; HET: HEM; 1.80A {Chlamydomonas eugametos} SCOP: a.1.1.1 PDB: 1uvx_A* Back     alignment and structure
>2ksc_A Cyanoglobin; hemeprotein, 2/2 hemoglobin, GLBN, TRHBN, unknown function; HET: HEB; NMR {Synechococcus SP} Back     alignment and structure
>2ig3_A Group III truncated haemoglobin; truncated hemoglobin, 2-ON-2 globin, oxygen storage-transpor; HET: HEM; 2.15A {Campylobacter jejuni} Back     alignment and structure
>2xyk_A 2-ON-2 hemoglobin; oxygen storage-transport complex; HET: HEM; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d2gdma_153 a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus 9e-30
d1d8ua_165 a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice 3e-27
d1fsla_143 a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), 2e-25
d1b0ba_142 a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) 2e-18
d1mbaa_146 a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia lim 4e-18
d1hlba_157 a.1.1.2 (A:) Hemoglobin, different isoforms {Caudi 4e-18
d1jl7a_147 a.1.1.2 (A:) Glycera globin {Marine bloodworm (Gly 4e-18
d1x9fa_147 a.1.1.2 (A:) Extracellular dodecameric hemoglobin 7e-17
d1cqxa1150 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal doma 9e-17
d1q1fa_148 a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [Ta 5e-16
d1sctb_150 a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca ina 6e-16
d1a6ma_151 a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter cato 8e-16
d1x9fd_140 a.1.1.2 (D:) Extracellular dodecameric hemoglobin 9e-16
d1gvha1146 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal doma 1e-15
d1hlma_158 a.1.1.2 (A:) Hemoglobin, different isoforms {Caudi 1e-15
d1urva_154 a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [Tax 2e-15
d1scta_149 a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca ina 3e-15
d1x9fb_145 a.1.1.2 (B:) Extracellular dodecameric hemoglobin 6e-15
d1ecda_136 a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thu 1e-14
d1vhba_144 a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreos 2e-14
d1x9fc_149 a.1.1.2 (C:) Extracellular dodecameric hemoglobin 2e-13
d2dn3b1145 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Human (H 4e-13
d1h97a_147 a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Param 4e-13
d1it2a_146 a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish ( 1e-12
d3sdha_145 a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca ina 2e-12
d1lhta_153 a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Car 5e-12
d2lhba_149 a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyz 2e-11
d1outb_146 a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorh 6e-11
d1v4wb_146 a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna 1e-10
d1itha_141 a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis c 1e-10
d1kr7a_110 a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural 2e-10
d1myta_146 a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus al 3e-10
d1jeba_141 a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo 1e-09
d1spga_143 a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiost 3e-09
d1outa_142 a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncor 3e-09
d2qfka1137 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite orn 3e-09
d1wmub_146 a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant 4e-09
d3d1ka1142 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarct 5e-09
d1cg5b_141 a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous 5e-09
d2aa1b1146 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarcti 8e-09
d3d1kb1146 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarcti 2e-08
d1wmua_141 a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra gian 2e-08
d2dn3a1140 a.1.1.2 (A:2-141) Hemoglobin, alpha-chain {Human ( 2e-08
d1tu9a_131 a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomo 4e-08
d1spgb_147 a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiosto 7e-08
d1xq5a_142 a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch 9e-08
d1cg5a_141 a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginou 2e-07
d1a4fa_141 a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed g 3e-07
d1gcva_140 a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark ( 2e-06
d1gcvb_136 a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (M 7e-04
>d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]} Length = 153 Back     information, alignment and structure

class: All alpha proteins
fold: Globin-like
superfamily: Globin-like
family: Globins
domain: Leghemoglobin
species: Yellow lupin (Lupinus luteus) [TaxId: 3873]
 Score =  103 bits (258), Expect = 9e-30
 Identities = 79/152 (51%), Positives = 95/152 (62%), Gaps = 5/152 (3%)

Query: 3   FTEKQEALVNESWEILKEISHKIACV---SSPQIAPAAKGMFSFLRDSDGIPQNNPKLKA 59
            TE Q ALV  SWE       K          +IAPAAK +FSFL+ +  +PQNNP+L+A
Sbjct: 3   LTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQA 62

Query: 60  HAVKVFKMTCESAIQLREKGKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEA 119
           HA KVFK+  E+AIQL   G   V D TLK LGSVH+  GV D HF VVKEA+L+ IKE 
Sbjct: 63  HAGKVFKLVYEAAIQLEVTGV-VVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEV 121

Query: 120 VGEKW-RDMNCTWVEAYDQLAAAIKAEMKEEA 150
           VG KW  ++N  W  AYD+LA  IK EM + A
Sbjct: 122 VGAKWSEELNSAWTIAYDELAIVIKKEMDDAA 153


>d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]} Length = 165 Back     information, alignment and structure
>d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]} Length = 143 Back     information, alignment and structure
>d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]} Length = 142 Back     information, alignment and structure
>d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]} Length = 146 Back     information, alignment and structure
>d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Length = 157 Back     information, alignment and structure
>d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]} Length = 147 Back     information, alignment and structure
>d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 147 Back     information, alignment and structure
>d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 150 Back     information, alignment and structure
>d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Back     information, alignment and structure
>d1sctb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Length = 150 Back     information, alignment and structure
>d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} Length = 151 Back     information, alignment and structure
>d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 140 Back     information, alignment and structure
>d1gvha1 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1hlma_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Length = 158 Back     information, alignment and structure
>d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1scta_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Length = 149 Back     information, alignment and structure
>d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 145 Back     information, alignment and structure
>d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]} Length = 136 Back     information, alignment and structure
>d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]} Length = 144 Back     information, alignment and structure
>d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 149 Back     information, alignment and structure
>d2dn3b1 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]} Length = 147 Back     information, alignment and structure
>d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]} Length = 146 Back     information, alignment and structure
>d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Length = 145 Back     information, alignment and structure
>d1lhta_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]} Length = 153 Back     information, alignment and structure
>d2lhba_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} Length = 149 Back     information, alignment and structure
>d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Length = 146 Back     information, alignment and structure
>d1v4wb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} Length = 146 Back     information, alignment and structure
>d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]} Length = 141 Back     information, alignment and structure
>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]} Length = 110 Back     information, alignment and structure
>d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]} Length = 146 Back     information, alignment and structure
>d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Length = 143 Back     information, alignment and structure
>d1outa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Length = 142 Back     information, alignment and structure
>d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]} Length = 137 Back     information, alignment and structure
>d1wmub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Length = 146 Back     information, alignment and structure
>d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Length = 142 Back     information, alignment and structure
>d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Length = 141 Back     information, alignment and structure
>d2aa1b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Length = 146 Back     information, alignment and structure
>d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Length = 146 Back     information, alignment and structure
>d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Length = 141 Back     information, alignment and structure
>d2dn3a1 a.1.1.2 (A:2-141) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]} Length = 131 Back     information, alignment and structure
>d1spgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Length = 147 Back     information, alignment and structure
>d1xq5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens) [TaxId: 8167]} Length = 142 Back     information, alignment and structure
>d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Length = 141 Back     information, alignment and structure
>d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]} Length = 141 Back     information, alignment and structure
>d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Length = 140 Back     information, alignment and structure
>d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d2gdma_153 Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxI 100.0
d1d8ua_165 Non-symbiotic plant hemoglobin {Rice (Oryza sativa 100.0
d1urva_154 Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1cg5b_141 Hemoglobin, beta-chain {Cartilaginous fish akaei ( 100.0
d1fsla_143 Leghemoglobin {Soybean (Glycine max), isoform A [T 100.0
d1xq5a_142 Hemoglobin, alpha-chain {Yellow perch (Perca flave 100.0
d1wmua_141 Hemoglobin, alpha-chain {Aldabra giant tortoise (G 100.0
d1jeba_141 Hemoglobin, alpha-chain {Human (Homo sapiens), zet 100.0
d1lhta_153 Myoglobin {Loggerhead sea turtle (Caretta caretta) 100.0
d1outa_142 Hemoglobin, alpha-chain {Trout (Oncorhynchus mykis 100.0
d3d1ka1142 Hemoglobin, alpha-chain {Antarctic fish (Trematomu 100.0
d1a4fa_141 Hemoglobin, alpha-chain {Bar-headed goose (Anser i 100.0
d1hlma_158 Hemoglobin, different isoforms {Caudina arenicola, 100.0
d1spga_143 Hemoglobin, alpha-chain {Fish (Leiostomus xanthuru 100.0
d3d1kb1146 Hemoglobin, beta-chain {Antarctic fish (Trematomus 100.0
d1a6ma_151 Myoglobin {Sperm whale (Physeter catodon) [TaxId: 100.0
d1hlba_157 Hemoglobin, different isoforms {Caudina arenicola, 100.0
d1cg5a_141 Hemoglobin, alpha-chain {Cartilaginous fish akaei 100.0
d1v4wb_146 Hemoglobin, beta-chain {Bluefin tuna (Thunnus thyn 100.0
d2dn3b1145 Hemoglobin, beta-chain {Human (Homo sapiens) [TaxI 100.0
d1q1fa_148 Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1gcva_140 Hemoglobin, alpha-chain {Houndshark (Mustelus gris 100.0
d2dn3a1140 Hemoglobin, alpha-chain {Human (Homo sapiens) [Tax 100.0
d1jl7a_147 Glycera globin {Marine bloodworm (Glycera dibranch 100.0
d1wmub_146 Hemoglobin, beta-chain {Aldabra giant tortoise (Ge 100.0
d1mbaa_146 Myoglobin {Slug sea hare (Aplysia limacina) [TaxId 100.0
d2aa1b1146 Hemoglobin, beta-chain {Antarctic fish (Trematomus 100.0
d1gcvb_136 Hemoglobin, beta-chain {Houndshark (Mustelus grise 100.0
d1outb_146 Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss 100.0
d1scta_149 Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ 100.0
d1spgb_147 Hemoglobin, beta-chain {Fish (Leiostomus xanthurus 100.0
d1cqxa1150 Flavohemoglobin, N-terminal domain {Alcaligenes eu 100.0
d1vhba_144 Bacterial dimeric hemoglobin {Vitreoscilla stercor 100.0
d1b0ba_142 Hemoglobin I {Clam (Lucina pectinata) [TaxId: 2916 100.0
d1itha_141 Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 100.0
d1myta_146 Myoglobin {Yellowfin tuna (Thunnus albacares) [Tax 100.0
d3sdha_145 Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ 100.0
d1sctb_150 Hemoglobin I {Ark clam (Scapharca inaequivalvis) [ 100.0
d1x9fb_145 Extracellular dodecameric hemoglobin (erythrocruor 100.0
d1gvha1146 Flavohemoglobin, N-terminal domain {Escherichia co 100.0
d1it2a_146 Hagfish hemoglobin {Inshore hagfish (Eptatretus bu 100.0
d2lhba_149 Lamprey globin {Sea lamprey (Petromyzon marinus) [ 100.0
d1ecda_136 Erythrocruorin {Midge (Chironomus thummi thummi), 100.0
d1x9fd_140 Extracellular dodecameric hemoglobin (erythrocruor 100.0
d1h97a_147 Trematode hemoglobin/myoglobin {Paramphistomum epi 100.0
d1x9fc_149 Extracellular dodecameric hemoglobin (erythrocruor 100.0
d1x9fa_147 Extracellular dodecameric hemoglobin (erythrocruor 99.98
d2qfka1137 Dehaloperoxidase {Amphitrite ornata [TaxId: 129555 99.97
d1asha_147 Ascaris hemoglobin, domain 1 {Pig roundworm (Ascar 99.95
d1tu9a_131 Hypothetical protein PA3967 {Pseudomonas aeruginos 99.93
d1kr7a_110 Nerve tissue mini-hemoglobin (neural globin) {Milk 99.92
d1or4a_169 Heme-based aerotactic transducer HemAT, sensor dom 99.11
d1dlya_121 Protozoan/bacterial hemoglobin {Green alga (Chlamy 97.65
d1ngka_126 Protozoan/bacterial hemoglobin {Mycobacterium tube 97.43
d1dlwa_116 Protozoan/bacterial hemoglobin {Ciliate (Parameciu 97.4
d1ux8a_119 Protozoan/bacterial hemoglobin {Bacillus subtilis 97.22
d1idra_127 Protozoan/bacterial hemoglobin {Mycobacterium tube 97.15
d1s69a_123 Protozoan/bacterial hemoglobin {Cyanobacteria (Syn 94.78
>d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
class: All alpha proteins
fold: Globin-like
superfamily: Globin-like
family: Globins
domain: Leghemoglobin
species: Yellow lupin (Lupinus luteus) [TaxId: 3873]
Probab=100.00  E-value=5.8e-40  Score=230.92  Aligned_cols=148  Identities=54%  Similarity=0.831  Sum_probs=137.6

Q ss_pred             CCCHHHHHHHHHHHHHHHhcchhhh---hhhccccCCchhhcCccCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHhccc
Q 037487            2 VFTEKQEALVNESWEILKEISHKIA---CVSSPQIAPAAKGMFSFLRDSDGIPQNNPKLKAHAVKVFKMTCESAIQLREK   78 (151)
Q Consensus         2 ~Lt~~e~~~i~~SW~~v~~~~~~~~---y~~lF~~~P~~~~~F~~~~~~~~~l~~~~~~~~H~~~v~~~l~~~i~~l~~~   78 (151)
                      +||++|+++|++||+.+.++...+|   |.+||+.||++|++|+.+++....+.++|.|+.|+.+|+..++.+|.+|+++
T Consensus         2 ~Lt~~q~~li~~SW~~v~~~~~~~g~~~f~~lF~~~P~~k~~F~~~~~~~~~~~~~~~~~~h~~~v~~~l~~~i~~ld~~   81 (153)
T d2gdma_           2 ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLEVT   81 (153)
T ss_dssp             CCCHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHCGGGGGGCTTTTTCSSCCSSCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHCHHHHHHhhhcCCCchhhhcCHHHHHHHHHHHHHHHHHHHhhccc
Confidence            6999999999999999999999998   9999999999999999876655577999999999999999999999999987


Q ss_pred             CchhhHHHHHHHHHHHHhhCCCCCchHhHHHHHHHHHHHHHhcccChh-HHHHHHHHHHHHHHHHHHhhchhh
Q 037487           79 GKVTVADTTLKYLGSVHLKNGVLDPHFEVVKEALLRAIKEAVGEKWRD-MNCTWVEAYDQLAAAIKAEMKEEA  150 (151)
Q Consensus        79 ~~l~~~~~~l~~Lg~~H~~~gv~~~~f~~~~~~ll~~l~~~lg~~~~~-~~~AW~~~~~~i~~~i~~~~~~~~  150 (151)
                      +.+ .+...+++||++|.+|||+|+||+.|+++|+.++++.+|..|++ +++||.++|+.|++.|+++|+++|
T Consensus        82 ~~~-~~~~~l~~lg~~H~~~gv~~~~f~~~~~~l~~~i~~~lg~~~~~e~~~AW~~~~~~i~~~~~~~~~~~a  153 (153)
T d2gdma_          82 GVV-VTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKEMDDAA  153 (153)
T ss_dssp             SSC-CCCHHHHHHHHHHHHTTCCGGGHHHHHHHHHHHHHHHHGGGCCHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             chh-hHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHhCccCCHHHHHHHHHHHHHHHHHHHHHhhhcC
Confidence            754 12467999999999999999999999999999999999999999 999999999999999999998875



>d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Back     information, alignment and structure
>d1fsla_ a.1.1.2 (A:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]} Back     information, alignment and structure
>d1xq5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Yellow perch (Perca flavescens) [TaxId: 8167]} Back     information, alignment and structure
>d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Back     information, alignment and structure
>d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1lhta_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]} Back     information, alignment and structure
>d1outa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Back     information, alignment and structure
>d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Back     information, alignment and structure
>d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]} Back     information, alignment and structure
>d1hlma_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Back     information, alignment and structure
>d1spga_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Back     information, alignment and structure
>d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Back     information, alignment and structure
>d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} Back     information, alignment and structure
>d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]} Back     information, alignment and structure
>d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Back     information, alignment and structure
>d1v4wb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]} Back     information, alignment and structure
>d2dn3b1 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Back     information, alignment and structure
>d2dn3a1 a.1.1.2 (A:2-141) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]} Back     information, alignment and structure
>d1wmub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} Back     information, alignment and structure
>d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]} Back     information, alignment and structure
>d2aa1b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} Back     information, alignment and structure
>d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} Back     information, alignment and structure
>d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss) [TaxId: 8022]} Back     information, alignment and structure
>d1scta_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Back     information, alignment and structure
>d1spgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]} Back     information, alignment and structure
>d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]} Back     information, alignment and structure
>d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]} Back     information, alignment and structure
>d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]} Back     information, alignment and structure
>d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]} Back     information, alignment and structure
>d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Back     information, alignment and structure
>d1sctb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} Back     information, alignment and structure
>d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1gvha1 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]} Back     information, alignment and structure
>d2lhba_ a.1.1.2 (A:) Lamprey globin {Sea lamprey (Petromyzon marinus) [TaxId: 7757]} Back     information, alignment and structure
>d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]} Back     information, alignment and structure
>d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]} Back     information, alignment and structure
>d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]} Back     information, alignment and structure
>d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]} Back     information, alignment and structure
>d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dlya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]} Back     information, alignment and structure
>d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]} Back     information, alignment and structure
>d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]} Back     information, alignment and structure
>d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]} Back     information, alignment and structure
>d1s69a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure