Citrus Sinensis ID: 037516

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MLIIMVTWASLVMSRTLHEDSISAKHELWMAQSARTYKNQAEKAMRFKIFKKNFRFIEKFNREGNQTYKLSLNEFADLTDEEFIASHTGYKMPTRNISNQSQSYANNWFGYPDSRRGLPRSIDWRARGAVTPVKNQGSCGCCWIFSAVAAVEGITKIRTGRLISLSEQQVLDCSGSRGCYGGWMDDAFSYIIRSQGLTDERVYPYQRREGYCNWQRGAMKAARIRSYQDVPTSELALRYAVSRQPVSVAIDASSPGFRYYSGGVFAGPCGNNLNHAVTIVGYGSSNEGPYWLIKNSWGQNWGEGGFIRMRRDVGGAGLCGIARKASYPIA
cHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEccCECccccHHHHHHHHHccccEEEECccccccccccccEEcccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEECccccccccccccccccccc
MLIIMVTWASLVMSRTLHEDSISAKHELWMAQSARTYKNQAEKAMRFKIFKKNFRFIEKFNREGNQTYKLSLNEFADLTDEEFIASHTGYKM**************NWFGYPDSRRGLPRSIDWRARGAVTPVKNQGSCGCCWIFSAVAAVEGITKIRTGRLISLSEQQVLDCSGSRGCYGGWMDDAFSYIIRSQGLTDERVYPYQRREGYCNWQRGAMKAARIRSYQDVPTSELALRYAVSRQPVSVAIDASSPGFRYYSGGVFAGPCGNNLNHAVTIVGYGSSNEGPYWLIKNSWGQNWGEGGFIRMRRDVGGAGLCGIARKASYPIA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIIMVTWASLVMSRTLHEDSISAKHELWMAQSARTYKNQAEKAMRFKIFKKNFRFIEKFNREGNQTYKLSLNEFADLTDEEFIASHTGYKMPTRNISNQSQSYANNWFGYPDSRRGLPRSIDWRARGAVTPVKNQGSCGCCWIFSAVAAVEGITKIRTGRLISLSEQQVLDCSGSRGCYGGWMDDAFSYIIRSQGLTDERVYPYQRREGYCNWQRGAMKAARIRSYQDVPTSELALRYAVSRQPVSVAIDASSPGFRYYSGGVFAGPCGNNLNHAVTIVGYGSSNEGPYWLIKNSWGQNWGEGGFIRMRRDVGGAGLCGIARKASYPIA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cathepsin K Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.probableP61277
Cathepsin K Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation (By similarity). Mediates thyroxine liberation by limited proteolysis of thyroglobulin at neutral pH in vitro.probableQ9GLE3
Cathepsin K Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.probableP43235

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.22.-Cysteine endopeptidases.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QJ3, chain A
Confidence level:very confident
Coverage over the Query: 17-330
View the alignment between query and template
View the model in PyMOL