Citrus Sinensis ID: 037659

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MQASQFLVTSTKRPAACSPLVPNPAHHRLTAASSTVRFRQISAVAAPPKPKTHSMPPEKVEVFKSLETWATNNVLPLLKPVEKCWQPQDFLPDPTLPFSDFTDQVRALRERTAGLPDDYFVVLVGDMITEDAIPTYQTMINTLDGVRDETGASSSPWAIWNRSWTAEENRHGDLLRSFLYLSGRVDMLMIEKTVQYLISAGM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccc
******************************************************MPPEKVEVFKSLETWATNNVLPLLKPVEKCWQPQDFLPDPTLPFSDFTDQVRALRERTAGLPDDYFVVLVGDMITEDAIPTYQTMINTLDGVRDETGASSSPWAIWNRSWTAEENRHGDLLRSFLYLSGRVDMLMIEKTVQYLISAGM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQASQFLVTSTKRPAACSPLVPNPAHHRLTAASSTVRFRQISAVAAPPKPKTHSMPPEKVEVFKSLETWATNNVLPLLKPVEKCWQPQDFLPDPTLPFSDFTDQVRALRERTAGLPDDYFVVLVGDMITEDAIPTYQTMINTLDGVRDETGASSSPWAIWNRSWTAEENRHGDLLRSFLYLSGRVDMLMIEKTVQYLISAGM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-[acyl-carrier-protein] desaturase 6, chloroplastic Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons Delta(9) and Delta(10) of the acyl chain.probableQ84VY3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.19.-With oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water.probable
1.14.19.2Acyl-[acyl-carrier-protein] desaturase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2UW1, chain A
Confidence level:very confident
Coverage over the Query: 60-202
View the alignment between query and template
View the model in PyMOL