Citrus Sinensis ID: 037679

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELRNL
cccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccccccHHccccccccEEEccccccccccccccccccccEEEccccccCCcccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHccccccccEEEccccccEEEEcccccccccccccccccccccccccEEEcccccccCCccHHHHHcccHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccCCccccccccccccEEEccccccCECccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEcccccccEEEcccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccc
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELRNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 448-606
View the alignment between query and template
View the model in PyMOL
Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 472-630
View the alignment between query and template
View the model in PyMOL
Template: 3BZ5, chain A
Confidence level:very confident
Coverage over the Query: 16-234,248-272
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 4-233,247-285,332-369
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 424-686
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 5-234,247-303,325-390,444-684
View the alignment between query and template
View the model in PyMOL
Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 169-285,330-399,430-678
View the alignment between query and template
View the model in PyMOL
Template: 3RIZ, chain A
Confidence level:probable
Coverage over the Query: 6-216,229-277,293-406,424-636
View the alignment between query and template
View the model in PyMOL