Citrus Sinensis ID: 037679

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELRNL
cccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccccccHHccccccccEEEccccccccccccccccccccEEEccccccEEcccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHccccccccEEEccccccEEEEcccccccccccccccccccccccccEEEcccccccEEccHHHHHcccHHHHHHHcccccccccccccccccccHHHHHHHcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccEEccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEcccccccEEEcccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccc
ccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEcccccccccccHHHHcccccccEEEcccccccccccHHHHHHcHHHHEHHccccccccccHHHccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEcccccccccccccccccccccccccHHHccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHcccHHHHHHHHHccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcHHHHHHHEccccccccccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEcccccccccccccccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHHcccc
MNLNKLSTLYLQHnqltghipVEIRKLTQLQIVRLAEnqlegsvpssIFELRNLQaldlsnnnlsgtVDLNMLLLNLKSLTALVLSSNKLSLLTRAtlntnlpnftvigfnscnlsefpyflhnqdelvsldlssnkiagqdllvlpwskmntldlgfnklqgplpvpslnglqaLDLSYnnlsgmlpeclGNFSVELSALKLQAnnfyrivpqtfmngtnlmMIDFSNNSLQGRALILKFNnfhgeieepqtgfefpklriidlshnrftgnlpskhfhcWNAMKDINASKLTYLQVKLlpydvlgftyygyadysltmsnkgteiEYLKLSNLIAAIIIsdknfvgeiptsisslkglrtlslsnnnlrggaipqgtqfstftndwfagnpglcgeplsrkcgnseaspveddppsesvlAFGWKIVLaggcglqgefpqeifqlpnlqflgvmknpnltgylpqfqksslleDLRLSYTrfsgkipdsienleslsylgisdcsfigkipsslfnltkLEHLYLSGnrfldelptsigNLASLKALEISSFNFSSTLQASlgnltqldsltisnsNFSRLMSSSLSwltnlnqltslnfpycnlnneipfgisnltQLTALDLsynqltgpipysLMKLKKVSSLLLGfnqlsgripveisnlTQLQSLQLssnqlegsvpssIFELRNL
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSeaspveddppsESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQlssnqlegsvpssifelrnl
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDlnmlllnlksltalvlSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTlslsnnnlRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTIsnsnfsrlmssslsWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYslmklkkvsslllGFNQLSGRIPVEIsnltqlqslqlssnqlEGSVPSSIFELRNL
******STLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCG***********************VLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLT**************************
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELRNL
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSR****************ESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPS********
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELRNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ yes no 0.891 0.494 0.299 1e-48
Q9FL28 1173 LRR receptor-like serine/ no no 0.929 0.549 0.308 2e-48
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.844 0.467 0.290 2e-46
Q9LYN8 1192 Leucine-rich repeat recep no no 0.946 0.550 0.289 1e-40
Q9SSL9 1123 Leucine-rich repeat recep no no 0.829 0.512 0.275 5e-39
C0LGS2 1136 Probable LRR receptor-lik no no 0.836 0.510 0.290 2e-38
Q9LP24 1120 Probable leucine-rich rep no no 0.898 0.556 0.276 5e-38
O49318 1124 Probable leucine-rich rep no no 0.819 0.505 0.282 8e-37
Q9LVP0 1102 Probable leucine-rich rep no no 0.839 0.528 0.291 1e-36
Q9LHP4 1141 Receptor-like protein kin no no 0.812 0.493 0.273 1e-35
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  195 bits (496), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 207/692 (29%), Positives = 322/692 (46%), Gaps = 74/692 (10%)

Query: 3   LNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNN 62
           L ++ +L LQ N L G IP E+   + L +   AEN L G++P+ +  L NL+ L+L+NN
Sbjct: 190 LVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANN 249

Query: 63  NLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLS-EFPYF 121
           +L+G +     L  +  L  L L +N+L  L   +L  +L N   +  ++ NL+ E P  
Sbjct: 250 SLTGEIPSQ--LGEMSQLQYLSLMANQLQGLIPKSL-ADLGNLQTLDLSANNLTGEIPEE 306

Query: 122 LHNQDELVSLDLSSNKIAGQDLLVLPWS------KMNTLDLGFNKLQGPLPVP--SLNGL 173
             N  +L+ L L++N ++G     LP S       +  L L   +L G +PV       L
Sbjct: 307 FWNMSQLLDLVLANNHLSGS----LPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSL 362

Query: 174 QALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQ 233
           + LDLS N+L+G +PE L    VEL+ L L  N     +  +  N TNL  +   +N+L+
Sbjct: 363 KQLDLSNNSLAGSIPEALFEL-VELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLE 421

Query: 234 GR------------ALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHC 281
           G+             L L  N F GEI  PQ       L++ID+  N F G +P      
Sbjct: 422 GKLPKEISALRKLEVLFLYENRFSGEI--PQEIGNCTSLKMIDMFGNHFEGEIPPS---- 475

Query: 282 WNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIII 341
              +K++N   L +L+   L          G    SL   ++            +  + +
Sbjct: 476 IGRLKELN---LLHLRQNEL---------VGGLPASLGNCHQ------------LNILDL 511

Query: 342 SDKNFVGEIPTSISSLKGLRTLSLSNNNLRGG------AIPQGTQFSTFTNDWFAGNPGL 395
           +D    G IP+S   LKGL  L L NN+L+G       ++   T+ +   N        L
Sbjct: 512 ADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPL 571

Query: 396 CGEP--LSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFL 453
           CG    LS    N   +  ED+ P E   +     +  G   L G+ P  + ++  L  L
Sbjct: 572 CGSSSYLSFDVTN---NGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLL 628

Query: 454 GVMKNPNLTGYLP-QFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKI 512
            +  N  LTG +P Q      L  + L+    SG IP  +  L  L  L +S   F+  +
Sbjct: 629 DMSSNA-LTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESL 687

Query: 513 PSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDS 572
           P+ LFN TKL  L L GN     +P  IGNL +L  L +    FS +L  ++G L++L  
Sbjct: 688 PTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYE 747

Query: 573 LTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLT 632
           L +S ++ +  +   +  L +L   ++L+  Y N   +IP  I  L++L  LDLS+NQLT
Sbjct: 748 LRLSRNSLTGEIPVEIGQLQDLQ--SALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLT 805

Query: 633 GPIPYSLMKLKKVSSLLLGFNQLSGRIPVEIS 664
           G +P S+  +K +  L + FN L G++  + S
Sbjct: 806 GEVPGSVGDMKSLGYLNVSFNNLGGKLKKQFS 837
Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
147794486 1924 hypothetical protein VITISV_000631 [Viti 0.597 0.215 0.402 8e-88
359485822 993 PREDICTED: receptor-like protein 12-like 0.623 0.435 0.401 2e-85
147766212 925 hypothetical protein VITISV_018438 [Viti 0.624 0.468 0.391 4e-85
225447578 1946 PREDICTED: uncharacterized protein LOC10 0.598 0.213 0.400 1e-84
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.626 0.432 0.379 1e-83
359485824 973 PREDICTED: receptor-like protein 12-like 0.619 0.440 0.391 4e-83
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.619 0.249 0.391 2e-79
255548694 984 serine/threonine-protein kinase bri1, pu 0.617 0.434 0.356 3e-79
147818103785 hypothetical protein VITISV_003452 [Viti 0.619 0.546 0.385 9e-77
359490156 886 PREDICTED: receptor-like protein 12-like 0.600 0.469 0.360 2e-76
>gi|147794486|emb|CAN71611.1| hypothetical protein VITISV_000631 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  331 bits (849), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 222/551 (40%), Positives = 282/551 (51%), Gaps = 137/551 (24%)

Query: 2    NLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSN 61
            NL  L+ L L++NQLTG IP  +  LT L+ + L  N LEG +PSSIFEL NL  L L  
Sbjct: 1322 NLTGLTYLNLEYNQLTGRIPPCLGNLTLLKXLGLGYNNLEGPIPSSIFELMNLDTLFLRA 1381

Query: 62   NNLSGTVDLNMLLLNLKSLTALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPYF 121
            N LSGTV+LNML+  LK+L  L LS N LSLLT  +LN +LP   ++G  SCNLSEFP+F
Sbjct: 1382 NKLSGTVELNMLV-KLKNLHXLGLSHNDLSLLTNNSLNGSLPRLRLLGLASCNLSEFPHF 1440

Query: 122  LHNQDELVSLDLSSNKIAGQ----------------DL------------LVLPWSKMNT 153
            L NQDEL  L LS NKI GQ                DL            +VLPW  +  
Sbjct: 1441 LRNQDELKFLTLSDNKIHGQIPKWMWNMGKETLWVMDLSNNLLTXFEQAPVVLPWITLRV 1500

Query: 154  LDLGFNKLQGPLPVP-----------------------SLNGLQALDLSYNNLSGMLPEC 190
            L+L +N+LQG LPVP                       SL+ L  LDLS NNLSGM+P+C
Sbjct: 1501 LELSYNQLQGSLPVPPXSISDYFVHNNRLNGKXPSLICSLHHLHILDLSNNNLSGMIPQC 1560

Query: 191  LGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRA-------------- 236
            L + S  LS L L+ NNF+  +PQTF +   L MIDFS N L+G+               
Sbjct: 1561 LXDSSDSLSVLNLRGNNFHGSIPQTFTSQCRLKMIDFSYNQLEGQIPRSLXNCKEXEILN 1620

Query: 237  ----------------------LILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNL 274
                                  LIL+ N FHG IE P+  FEFP L IIDLS+N F GNL
Sbjct: 1621 LGNNQINDTFPFWLGSLPELQLLILRHNRFHGAIESPRANFEFPTLCIIDLSYNXFAGNL 1680

Query: 275  PSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSN 334
            P+ +F  W AM  ++    +Y+Q       +  +  Y   +YS+TM+NKG E  Y K+  
Sbjct: 1681 PAGYFLTWVAMSRVDEEHFSYMQSMTGFVLIRTYRLYENYNYSMTMTNKGMERVYPKIPR 1740

Query: 335  LIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRG---------------------- 372
               AI +S   F+GEIP SI  L+GL  L++S+N+L G                      
Sbjct: 1741 SFKAIDLSSNKFIGEIPKSIGKLRGLHLLNISSNSLTGHIPSFLGNLAQLEALDLSQNNL 1800

Query: 373  -------------------------GAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKCGNS 407
                                     G IPQG QF+TF ND + GNPGLCG PLS++CGNS
Sbjct: 1801 SGEIPQQLKGMTFLEFFNVSHNHLMGPIPQGKQFNTFQNDSYEGNPGLCGNPLSKECGNS 1860

Query: 408  EASPVEDDPPS 418
            +++     PP+
Sbjct: 1861 KSTA--SSPPT 1869

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766212|emb|CAN63381.1| hypothetical protein VITISV_018438 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447578|ref|XP_002270154.1| PREDICTED: uncharacterized protein LOC100264911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548694|ref|XP_002515403.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223545347|gb|EEF46852.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147818103|emb|CAN73568.1| hypothetical protein VITISV_003452 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.900 0.499 0.276 1.8e-47
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.893 0.494 0.274 4.9e-44
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.923 0.545 0.275 3e-43
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.792 0.503 0.272 2.7e-26
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.479 0.409 0.319 6.2e-37
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.904 0.559 0.267 9.4e-37
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.913 0.555 0.259 3.8e-36
TAIR|locus:2094603835 RLP37 "receptor like protein 3 0.507 0.421 0.288 7.3e-36
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.894 0.545 0.265 5.4e-35
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.943 0.548 0.265 1.7e-34
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 508 (183.9 bits), Expect = 1.8e-47, P = 1.8e-47
 Identities = 187/676 (27%), Positives = 293/676 (43%)

Query:     3 LNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNN 62
             L ++ +L LQ N L G IP E+   + L +   AEN L G++P+ +  L NL+ L+L+NN
Sbjct:   190 LVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANN 249

Query:    63 NLSGTVDXXXXXXXXXXXXXXXXSSNKLSLLTRATLNTNLPNFTVIGFNSCNLS-EFPYF 121
             +L+G +                  +N+L  L   +L  +L N   +  ++ NL+ E P  
Sbjct:   250 SLTGEIPSQLGEMSQLQYLSLM--ANQLQGLIPKSL-ADLGNLQTLDLSANNLTGEIPEE 306

Query:   122 LHNQDELVSLDLSSNKIAGQ--DLLVLPWSKMNTLDLGFNKLQGPLPVP--SLNGLQALD 177
               N  +L+ L L++N ++G     +    + +  L L   +L G +PV       L+ LD
Sbjct:   307 FWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLD 366

Query:   178 LSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGR-- 235
             LS N+L+G +PE L    VEL+ L L  N     +  +  N TNL  +   +N+L+G+  
Sbjct:   367 LSNNSLAGSIPEALFEL-VELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLP 425

Query:   236 ----------ALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAM 285
                        L L  N F GEI  PQ       L++ID+  N F G +P         +
Sbjct:   426 KEISALRKLEVLFLYENRFSGEI--PQEIGNCTSLKMIDMFGNHFEGEIPPSI----GRL 479

Query:   286 KDINASKLTYLQ-VKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIIISDK 344
             K++N   L   + V  LP  +         D +    +      +  L  L   +++ + 
Sbjct:   480 KELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGL-EQLMLYNN 538

Query:   345 NFVGEIPTSISSLKGLRTXXXXXXXXRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLSRKC 404
             +  G +P S+ SL+ L T          G I                +P LCG   S   
Sbjct:   539 SLQGNLPDSLISLRNL-TRINLSHNRLNGTI----------------HP-LCGSS-SYLS 579

Query:   405 GNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGY 464
              +   +  ED+ P E   +     +  G   L G+ P  + ++  L  L +  N  LTG 
Sbjct:   580 FDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNA-LTGT 638

Query:   465 LP-QFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLE 523
             +P Q      L  + L+    SG IP  +  L  L  L +S   F+  +P+ LFN TKL 
Sbjct:   639 IPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLL 698

Query:   524 HLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTIXXXXXXXX 583
              L L GN     +P  IGNL +L  L +    FS +L  ++G L++L  L +        
Sbjct:   699 VLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGE 758

Query:   584 XXXXXXWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYXXXXXX 643
                    L +L   ++L+  Y N   +IP  I  L++L  LDLS+NQLTG +P       
Sbjct:   759 IPVEIGQLQDLQ--SALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMK 816

Query:   644 XXXXXXXGFNQLSGRI 659
                     FN L G++
Sbjct:   817 SLGYLNVSFNNLGGKL 832
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0008544 "epidermis development" evidence=IGI
GO:0009790 "embryo development" evidence=IGI
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029123001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (983 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-29
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-26
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-08
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-07
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  153 bits (389), Expect = 1e-38
 Identities = 165/599 (27%), Positives = 258/599 (43%), Gaps = 102/599 (17%)

Query: 2   NLNKLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSSIFEL-RNLQALDLS 60
           N +++ ++ L    ++G I   I +L  +Q + L+ NQL G +P  IF    +L+ L+LS
Sbjct: 67  NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLS 126

Query: 61  NNNLSGTVDLNMLLLNLKSLTALVLSSNKLS--LLTRATLNTNLPNFTVIGFNSCNLSEF 118
           NNN +G++    +      L  L LS+N LS  +       ++L     +G N   + + 
Sbjct: 127 NNNFTGSIPRGSIPN----LETLDLSNNMLSGEIPNDIGSFSSL-KVLDLGGNVL-VGKI 180

Query: 119 PYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLD---LGFNKLQGPLP--VPSLNGL 173
           P  L N   L  L L+SN++ GQ    L   +M +L    LG+N L G +P  +  L  L
Sbjct: 181 PNSLTNLTSLEFLTLASNQLVGQIPREL--GQMKSLKWIYLGYNNLSGEIPYEIGGLTSL 238

Query: 174 QALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQ 233
             LDL YNNL+G +P  LGN    L  L L  N     +P +  +   L+ +D S+NSL 
Sbjct: 239 NHLDLVYNNLTGPIPSSLGNLK-NLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS 297

Query: 234 GR--ALILKF----------NNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHC 281
           G    L+++           NNF G+I  P      P+L+++ L  N+F+G +P      
Sbjct: 298 GEIPELVIQLQNLEILHLFSNNFTGKI--PVALTSLPRLQVLQLWSNKFSGEIPK----- 350

Query: 282 WNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIAAIII 341
            N  K  N   LT L +                    T +  G   E L  S  +  +I+
Sbjct: 351 -NLGKHNN---LTVLDLS-------------------TNNLTGEIPEGLCSSGNLFKLIL 387

Query: 342 SDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLS 401
              +  GEIP S+ + + LR + L +N+   G +P               N  L G   S
Sbjct: 388 FSNSLEGEIPKSLGACRSLRRVRLQDNSF-SGELPSEFTKLPLVYFLDISNNNLQGRINS 446

Query: 402 RKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNL 461
           RK                                         + +P+LQ L + +N   
Sbjct: 447 RK-----------------------------------------WDMPSLQMLSLARN-KF 464

Query: 462 TGYLPQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTK 521
            G LP    S  LE+L LS  +FSG +P  + +L  L  L +S+    G+IP  L +  K
Sbjct: 465 FGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKK 524

Query: 522 LEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTISNSNF 580
           L  L LS N+   ++P S   +  L  L++S    S  +  +LGN+  L  + IS+++ 
Sbjct: 525 LVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHL 583

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.62
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.57
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.41
KOG0617264 consensus Ras suppressor protein (contains leucine 99.39
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.86
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.76
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.75
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.72
PLN03150623 hypothetical protein; Provisional 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.68
KOG4341483 consensus F-box protein containing LRR [General fu 98.67
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.66
PLN03150623 hypothetical protein; Provisional 98.63
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.13
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.11
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.08
KOG4341483 consensus F-box protein containing LRR [General fu 97.92
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.79
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
PRK15386 426 type III secretion protein GogB; Provisional 97.68
PRK15386 426 type III secretion protein GogB; Provisional 97.65
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.54
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.38
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.32
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.05
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.83
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.83
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.52
KOG4308 478 consensus LRR-containing protein [Function unknown 94.22
KOG4308478 consensus LRR-containing protein [Function unknown 93.41
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.88
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.74
smart0037026 LRR Leucine-rich repeats, outliers. 90.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.94
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.84
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.87
smart0037026 LRR Leucine-rich repeats, outliers. 84.87
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.34
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.42
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.2e-50  Score=473.30  Aligned_cols=516  Identities=31%  Similarity=0.456  Sum_probs=279.5

Q ss_pred             CccEEEcccccccCccchhhccCCCCcEEEccCCcCCCCCCcc-ccCCCCCcEEECCCCcCCCcccHHHHhhcCCCCCEE
Q 037679            5 KLSTLYLQHNQLTGHIPVEIRKLTQLQIVRLAENQLEGSVPSS-IFELRNLQALDLSNNNLSGTVDLNMLLLNLKSLTAL   83 (693)
Q Consensus         5 ~l~~L~ls~~~l~~~~~~~~~~~~~L~~L~ls~n~i~~~~~~~-~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~l~~L~~L   83 (693)
                      +++.|+++++.+++..+.+|..+++|++|++++|.+++.+|.. +.++.+|++|++++|.+.+..|    ...+++|++|
T Consensus        70 ~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p----~~~l~~L~~L  145 (968)
T PLN00113         70 RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIP----RGSIPNLETL  145 (968)
T ss_pred             cEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccC----ccccCCCCEE
Confidence            3444555555544444445555555555555555444333332 2245555555555554444333    1234455555


Q ss_pred             ECCCCcCCchhhhhhhcCCCCCcEEeccCCCCC-chhhhhhcCCCccEEEcCCCCCCCCCCCccCCCCCcEEeCCCCCCC
Q 037679           84 VLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLS-EFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDLGFNKLQ  162 (693)
Q Consensus        84 ~L~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~-~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~L~~L~l~~n~~~  162 (693)
                      ++++|.+....+..+. .+++|++|++++|.+. .+|..++++++|++|++++|.+                       .
T Consensus       146 ~Ls~n~~~~~~p~~~~-~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l-----------------------~  201 (968)
T PLN00113        146 DLSNNMLSGEIPNDIG-SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQL-----------------------V  201 (968)
T ss_pred             ECcCCcccccCChHHh-cCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCC-----------------------c
Confidence            5555544444444444 4455555555554443 3444444555555555555444                       4


Q ss_pred             CCCCC--CCCCCCCEEeCCCCCCCCCcccccccccccccEEEcccccccccccccccCCCCccEEEccCCcCCCceeeec
Q 037679          163 GPLPV--PSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALILK  240 (693)
Q Consensus       163 ~~~~~--~~l~~L~~L~L~~~~i~~~~~~~~~~~~~~L~~L~L~~~~i~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~l~  240 (693)
                      +..+.  ..+++|++|++++|.+.+..|..+..++ +|+.|++++|.+....|..+..+++|++|++++|+++       
T Consensus       202 ~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~-------  273 (968)
T PLN00113        202 GQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLT-SLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLS-------  273 (968)
T ss_pred             CcCChHHcCcCCccEEECcCCccCCcCChhHhcCC-CCCEEECcCceeccccChhHhCCCCCCEEECcCCeee-------
Confidence            33322  2445555555555555555555555555 5555555555555555555555555555555555442       


Q ss_pred             ccccCCCCCCCccCCCCCCceEEecCCCcccCCCCCcccccchhhhhhhcccccchhccccccccccceeccccccceee
Q 037679          241 FNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTM  320 (693)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (693)
                           +..+..  +..+++|+.|++++|.+.+.+|.. +..                                       
T Consensus       274 -----~~~p~~--l~~l~~L~~L~Ls~n~l~~~~p~~-~~~---------------------------------------  306 (968)
T PLN00113        274 -----GPIPPS--IFSLQKLISLDLSDNSLSGEIPEL-VIQ---------------------------------------  306 (968)
T ss_pred             -----ccCchh--HhhccCcCEEECcCCeeccCCChh-HcC---------------------------------------
Confidence                 112211  134455555555555554433321 111                                       


Q ss_pred             cCCCchhhhhhhhhhhhheeecCCcccccCChhhhcCCCCCeeeCccccccCCCCCCCCcccccccCcccCCCCCcCCCc
Q 037679          321 SNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCGEPL  400 (693)
Q Consensus       321 ~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~~~~~~~~l~~~~~  400 (693)
                                  +.+|+.|++++|.+.+..|.++..+++|++|++++|.+..                            
T Consensus       307 ------------l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~----------------------------  346 (968)
T PLN00113        307 ------------LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSG----------------------------  346 (968)
T ss_pred             ------------CCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcC----------------------------
Confidence                        1234445555555555555555566666666666555442                            


Q ss_pred             cccCCCCCCCCCCCCCCcccccccceEEEEecCCCcccccCccccCCCCcceeecccCCCcCCCcccccccccCCeeEec
Q 037679          401 SRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLLEDLRLS  480 (693)
Q Consensus       401 ~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~  480 (693)
                                                            .+|..+..+++|+.|+++.|......+..+..++.|+.++++
T Consensus       347 --------------------------------------~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~  388 (968)
T PLN00113        347 --------------------------------------EIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILF  388 (968)
T ss_pred             --------------------------------------cCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECc
Confidence                                                  123334445555555555553222222234445556666666


Q ss_pred             ccccCCCchhhhhcCCCCcEEeccCCcccccccccccccCCCcEEEeeCCcCCCCccccccCCccccEEEecCccccccc
Q 037679          481 YTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTL  560 (693)
Q Consensus       481 ~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~~~~~~~~  560 (693)
                      +|.+.+..+..+..+++|+.|++++|.++...|..+..+++|+.|++++|.+.+..+..+..+++|+.|++++|++.+..
T Consensus       389 ~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~  468 (968)
T PLN00113        389 SNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGL  468 (968)
T ss_pred             CCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeec
Confidence            66666555666666666666666666666556666666666666666666666655555556666666666666665554


Q ss_pred             hhccCCCCCCcEEecccCCCCccccchhHhhhcCCCCcEEEccCCCCCCcccccccCCCCCCEEEccCCccCCCcccccc
Q 037679          561 QASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLM  640 (693)
Q Consensus       561 ~~~l~~l~~L~~L~ls~n~l~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~  640 (693)
                      +..+ ..++|+.|++++|.+....+.   .+..+++|++|++++|.+.+.+|..+.++++|+.|++++|.+++.+|..+.
T Consensus       469 p~~~-~~~~L~~L~ls~n~l~~~~~~---~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~  544 (968)
T PLN00113        469 PDSF-GSKRLENLDLSRNQFSGAVPR---KLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFS  544 (968)
T ss_pred             Cccc-ccccceEEECcCCccCCccCh---hhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHh
Confidence            4433 335666666666666544333   234556666677777766666666666667777777777776666666666


Q ss_pred             CcCcccEEeccCccCCCCcchhhcCCCCCCeEEccCCcccCCccC
Q 037679          641 KLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPS  685 (693)
Q Consensus       641 ~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~  685 (693)
                      .+++|+.|++++|++.+.+|..+..+++|++|++++|++.+.+|+
T Consensus       545 ~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        545 EMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             CcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC
Confidence            666777777777777666666666677777777777776666664

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-16
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-13
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-16
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-15
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-11
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 173/676 (25%), Positives = 265/676 (39%), Gaps = 101/676 (14%)
Query: 6   LSTLYLQHNQLTGHIPV--EIRKLTQLQIVRLAENQLE--GSVPSSIFELRNLQALDLSN 61
           L++L L  N L+G +     +   + L+ + ++ N L+  G V S   +L +L+ LDLS 
Sbjct: 102 LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKV-SGGLKLNSLEVLDLSA 160
Query: 62  NNLSGT-VDXXXXXXXXXXXXXXXXSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFPY 120
           N++SG  V                 S NK+S     +   NL    V   +S N S    
Sbjct: 161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDV---SSNNFSTGIP 217
Query: 121 FLHNQDELVSLDLSSNKIAGQ-DLLVLPWSKMNTLDLGFNKLQGPLPVPSLNGLQALDLS 179
           FL +   L  LD+S NK++G     +   +++  L++  N+  GP+P   L  LQ L L+
Sbjct: 218 FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLA 277
Query: 180 YNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGRALIL 239
            N  +G +P+ L      L+ L L  N+FY  VP  F             +     +L L
Sbjct: 278 ENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFF------------GSCSLLESLAL 325
Query: 240 KFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVK 299
             NNF GE+    T  +   L+++DLS N F+G LP                 LT L   
Sbjct: 326 SSNNFSGELPM-DTLLKMRGLKVLDLSFNEFSGELPES---------------LTNLSAS 369
Query: 300 LLPYDVLGFTYYGYADYSLTMSNKGTEIE-YLK-----------LSNL--IAAIIISDKN 345
           LL  D+    + G    +L  + K T  E YL+           LSN   + ++ +S   
Sbjct: 370 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 429
Query: 346 FVGEIPTSISSLKGLRTXXXXXXXXRGGAIPQGTQFSTFTNDWFAGNPGLCGEPLS--RK 403
             G IP+S+ SL  LR          G  IPQ   +             L GE  S    
Sbjct: 430 LSGTIPSSLGSLSKLRDLKLWLNMLEG-EIPQELMYVKTLETLILDFNDLTGEIPSGLSN 488
Query: 404 CGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTG 463
           C N                   W I L+    L GE P+ I +L NL  L +  N + +G
Sbjct: 489 CTN-----------------LNW-ISLSNN-RLTGEIPKWIGRLENLAILKLSNN-SFSG 528
Query: 464 YLP-QFQKSSLLEDLRLSYTRFSGKIPDSIEN---------LESLSYLGIS------DC- 506
            +P +      L  L L+   F+G IP ++           +    Y+ I       +C 
Sbjct: 529 NIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECH 588
Query: 507 ------SFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTL 560
                  F G     L  L+      ++   +      +  N  S+  L++S    S  +
Sbjct: 589 GAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYI 648
Query: 561 QASLGNLTQLDSLTIXXXXXXXXXXXXXXWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQ 620
              +G++  L  L +               + +L  L  L+     L+  IP  +S LT 
Sbjct: 649 PKEIGSMPYLFILNLGHNDISGSIPDE---VGDLRGLNILDLSSNKLDGRIPQAMSALTM 705
Query: 621 LTALDLSYNQLTGPIP 636
           LT +DLS N L+GPIP
Sbjct: 706 LTEIDLSNNNLSGPIP 721
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-102
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-84
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-52
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-54
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-43
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-41
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-26
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-32
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-26
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-19
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-17
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-14
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-12
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-09
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-10
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-07
3e6j_A 229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  328 bits (843), Expect = e-102
 Identities = 173/717 (24%), Positives = 279/717 (38%), Gaps = 133/717 (18%)

Query: 2   NLNKLSTLYLQHNQLTGHIP--VEIRKLTQLQIVRLAENQLEGSVPSSIFE-LRNLQALD 58
               L++L L  N L+G +     +   + L+ + ++ N L+     S    L +L+ LD
Sbjct: 98  CSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLD 157

Query: 59  LSNNNLSGTVDLNMLLL-NLKSLTALVLSSNKLSLLTRATLN-TNLPNFTVIGFNSCNLS 116
           LS N++SG   +  +L      L  L +S NK+S      ++ +   N   +  +S N S
Sbjct: 158 LSANSISGANVVGWVLSDGCGELKHLAISGNKIS----GDVDVSRCVNLEFLDVSSNNFS 213

Query: 117 -EFPYFLHNQDELVSLDLSSNKIAGQDLLVLPWS-----KMNTLDLGFNKLQGPLPVPSL 170
              P FL +   L  LD+S NK++G        +     ++  L++  N+  GP+P   L
Sbjct: 214 TGIP-FLGDCSALQHLDISGNKLSGD----FSRAISTCTELKLLNISSNQFVGPIPPLPL 268

Query: 171 NGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNN 230
             LQ L L+ N  +G +P+ L      L+ L L  N+FY  VP  F + + L  +  S+N
Sbjct: 269 KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSN 328

Query: 231 SLQG-------------RALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSK 277
           +  G             + L L FN F GE+           L  +DLS N F+G +   
Sbjct: 329 NFSGELPMDTLLKMRGLKVLDLSFNEFSGELP-ESLTNLSASLLTLDLSSNNFSGPILP- 386

Query: 278 HFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYADYSLTMSNKGTEIEYLKLSNLIA 337
                    ++  +    LQ                                        
Sbjct: 387 ---------NLCQNPKNTLQE--------------------------------------- 398

Query: 338 AIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPGLCG 397
            + + +  F G+IP ++S+   L +L LS N L G  IP                  L  
Sbjct: 399 -LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG-TIPS----------SLGSLSKL-- 444

Query: 398 EPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMK 457
                                        + +      L+GE PQE+  +  L+ L +  
Sbjct: 445 -----------------------------RDLKLWLNMLEGEIPQELMYVKTLETLILDF 475

Query: 458 NPNLTGYLPQ-FQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSL 516
           N +LTG +P      + L  + LS  R +G+IP  I  LE+L+ L +S+ SF G IP+ L
Sbjct: 476 N-DLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL 534

Query: 517 FNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSFNFSSTLQASLGNLTQLDSLTIS 576
            +   L  L L+ N F   +P ++   +      I++   +      + N         +
Sbjct: 535 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGK----IAANFIAGKRYVYIKNDGMKKECHGA 590

Query: 577 NSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIP 636
             N           L  L+     N               N   +  LD+SYN L+G IP
Sbjct: 591 G-NLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP 649

Query: 637 YSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSSIFELRNL 693
             +  +  +  L LG N +SG IP E+ +L  L  L LSSN+L+G +P ++  L  L
Sbjct: 650 KEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTML 706
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.52
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.45
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.42
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.2
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.89
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.83
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.22
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.51
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.12
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.14
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7e-59  Score=535.80  Aligned_cols=598  Identities=28%  Similarity=0.373  Sum_probs=483.1

Q ss_pred             CCccEEEcccccccCc---cchhhccCCCCcEEEccCCcCCCCCCccccCCCCCcEEECCCCcCCCcccHHHHhhcCCCC
Q 037679            4 NKLSTLYLQHNQLTGH---IPVEIRKLTQLQIVRLAENQLEGSVPSSIFELRNLQALDLSNNNLSGTVDLNMLLLNLKSL   80 (693)
Q Consensus         4 ~~l~~L~ls~~~l~~~---~~~~~~~~~~L~~L~ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~l~~l~~L   80 (693)
                      .+++.|+++++.+.+.   ++.+|..+++|+.++++.+.+. ..+..|.++++|++|+|++|.+.+.++....++++++|
T Consensus        50 ~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~-~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L  128 (768)
T 3rgz_A           50 DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHIN-GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGL  128 (768)
T ss_dssp             TEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEE-ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTC
T ss_pred             CcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcC-CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCC
Confidence            4688999999999987   8899999999999999999875 35678999999999999999998877762128999999


Q ss_pred             CEEECCCCcCCchhhhhhhcCCCCCcEEeccCCCCCchh-hh---hhcCCCccEEEcCCCCCCCCCCCccCCCCCcEEeC
Q 037679           81 TALVLSSNKLSLLTRATLNTNLPNFTVIGFNSCNLSEFP-YF---LHNQDELVSLDLSSNKIAGQDLLVLPWSKMNTLDL  156 (693)
Q Consensus        81 ~~L~L~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~-~~---l~~l~~L~~L~L~~~~~~~~~~~~~~~~~L~~L~l  156 (693)
                      ++|++++|.+....+..+..++++|++|++++|.++..+ ..   ++++++|++|++++|.++. ......+++|++|++
T Consensus       129 ~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~-~~~~~~l~~L~~L~L  207 (768)
T 3rgz_A          129 KFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISG-DVDVSRCVNLEFLDV  207 (768)
T ss_dssp             CEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEES-CCBCTTCTTCCEEEC
T ss_pred             CEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccc-cCCcccCCcCCEEEC
Confidence            999999999887777665348999999999999998544 33   7899999999999999987 444578999999999


Q ss_pred             CCCCCCCCCC-CCCCCCCCEEeCCCCCCCCCcccccccccccccEEEcccccccccccccccCCCCccEEEccCCcCCCc
Q 037679          157 GFNKLQGPLP-VPSLNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANNFYRIVPQTFMNGTNLMMIDFSNNSLQGR  235 (693)
Q Consensus       157 ~~n~~~~~~~-~~~l~~L~~L~L~~~~i~~~~~~~~~~~~~~L~~L~L~~~~i~~~~~~~~~~~~~L~~L~l~~n~l~~~  235 (693)
                      ++|.+.+..+ +..+++|++|++++|.+++..+..+..++ +|+.|++++|.+....|..  .+++|++|++++|+++  
T Consensus       208 s~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~-~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~--  282 (768)
T 3rgz_A          208 SSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCT-ELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFT--  282 (768)
T ss_dssp             CSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCS-SCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEE--
T ss_pred             cCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCC-CCCEEECCCCcccCccCcc--ccCCCCEEECcCCccC--
Confidence            9999987544 46899999999999999999999999999 9999999999998776654  7899999999999874  


Q ss_pred             eeeecccccCCCCCCCccCCCCCCceEEecCCCcccCCCCCcccccchhhhhhhcccccchhccccccccccceeccccc
Q 037679          236 ALILKFNNFHGEIEEPQTGFEFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYAD  315 (693)
Q Consensus       236 ~~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  315 (693)
                                +.++... +..+++|+.|++++|++++.+|.. +..++.|+.++...-.....                 
T Consensus       283 ----------~~ip~~~-~~~~~~L~~L~Ls~n~l~~~~p~~-~~~l~~L~~L~L~~n~l~~~-----------------  333 (768)
T 3rgz_A          283 ----------GEIPDFL-SGACDTLTGLDLSGNHFYGAVPPF-FGSCSLLESLALSSNNFSGE-----------------  333 (768)
T ss_dssp             ----------ESCCCCS-CTTCTTCSEEECCSSEEEECCCGG-GGGCTTCCEEECCSSEEEEE-----------------
T ss_pred             ----------CccCHHH-HhhcCcCCEEECcCCcCCCccchH-HhcCCCccEEECCCCcccCc-----------------
Confidence                      2334333 133588999999999998766654 66677776665543221100                 


Q ss_pred             cceeecCCCchhhhhhhhhhhhheeecCCcccccCChhhhcCC-CCCeeeCccccccCCCCCCCCcccccccCcccCCCC
Q 037679          316 YSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLK-GLRTLSLSNNNLRGGAIPQGTQFSTFTNDWFAGNPG  394 (693)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~-~L~~L~l~~n~l~~~~~~~~~~~~~l~~~~~~~~~~  394 (693)
                               ...+.+..++.+++|++++|.+.+.+|.++..++ +|++|++++|.+.+ .+|.....             
T Consensus       334 ---------ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~-~~~~~~~~-------------  390 (768)
T 3rgz_A          334 ---------LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG-PILPNLCQ-------------  390 (768)
T ss_dssp             ---------CCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEE-ECCTTTTC-------------
T ss_pred             ---------CCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCC-CcChhhhh-------------
Confidence                     0112234456788888888888888888888776 88888888888764 33321100             


Q ss_pred             CcCCCccccCCCCCCCCCCCCCCcccccccceEEEEecCCCcccccCccccCCCCcceeecccCCCcCCCcccccccccC
Q 037679          395 LCGEPLSRKCGNSEASPVEDDPPSESVLAFGWKIVLAGGCGLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSLL  474 (693)
Q Consensus       395 l~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L  474 (693)
                                                .....++.+.+++|.+.+.+|..+..+++|++|++++|......+..+..+++|
T Consensus       391 --------------------------~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L  444 (768)
T 3rgz_A          391 --------------------------NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL  444 (768)
T ss_dssp             --------------------------STTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTC
T ss_pred             --------------------------cccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCC
Confidence                                      001246778888888888888888888888888888884333444557888888


Q ss_pred             CeeEecccccCCCchhhhhcCCCCcEEeccCCcccccccccccccCCCcEEEeeCCcCCCCccccccCCccccEEEecCc
Q 037679          475 EDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLASLKALEISSF  554 (693)
Q Consensus       475 ~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~~  554 (693)
                      ++|++++|.+.+..+..+..+++|++|++++|.++...|..+..+++|++|++++|++.+..|..++.+++|+.|++++|
T Consensus       445 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N  524 (768)
T 3rgz_A          445 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN  524 (768)
T ss_dssp             CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             CEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCC
Confidence            88888888888777788888888888888888887777878888888888888888887788888888888888888888


Q ss_pred             cccccchhccCCCCCCcEEecccCCCCccccchhH---------------------------------------------
Q 037679          555 NFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLS---------------------------------------------  589 (693)
Q Consensus       555 ~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~~~---------------------------------------------  589 (693)
                      ++.+..+..+..+++|+.|++++|.+.+..|..+.                                             
T Consensus       525 ~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  604 (768)
T 3rgz_A          525 SFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL  604 (768)
T ss_dssp             CCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGG
T ss_pred             cccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhh
Confidence            88877777788888888888888876533222110                                             


Q ss_pred             ----------------------hhhcCCCCcEEEccCCCCCCcccccccCCCCCCEEEccCCccCCCccccccCcCcccE
Q 037679          590 ----------------------WLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALDLSYNQLTGPIPYSLMKLKKVSS  647 (693)
Q Consensus       590 ----------------------~l~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~  647 (693)
                                            .+..+++|+.|++++|++++.+|..++++++|+.|++++|.+++.+|..+.++++|+.
T Consensus       605 ~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~  684 (768)
T 3rgz_A          605 NRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNI  684 (768)
T ss_dssp             GGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             hccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCE
Confidence                                  1334678999999999999999999999999999999999999999999999999999


Q ss_pred             EeccCccCCCCcchhhcCCCCCCeEEccCCcccCCccCc
Q 037679          648 LLLGFNQLSGRIPVEISNLTQLQSLQLSSNQLEGSVPSS  686 (693)
Q Consensus       648 L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~  686 (693)
                      |++++|++++.+|..++.+++|++||+++|++++.+|+.
T Consensus       685 LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          685 LDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             EECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS
T ss_pred             EECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            999999999999999999999999999999999999964
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 693
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_ 284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-05
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1h6ta2 210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 78.6 bits (192), Expect = 2e-16
 Identities = 64/266 (24%), Positives = 93/266 (34%), Gaps = 24/266 (9%)

Query: 152 NTLDLGFNKLQGPLPVPS----LNGLQALDLSYNNLSGMLPECLGNFSVELSALKLQANN 207
           N LDL    L  P P+PS    L  L  L +   N              +L  L +   N
Sbjct: 53  NNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTN 112

Query: 208 FYRIVPQTFMNGTNLMMIDFSNNSL------------QGRALILKFNNFHGEIEEPQTGF 255
               +P        L+ +DFS N+L                +    N   G I +   G 
Sbjct: 113 VSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPD-SYGS 171

Query: 256 EFPKLRIIDLSHNRFTGNLPSKHFHCWNAMKDINASKLTYLQVKLLPYDVLGFTYYGYAD 315
                  + +S NR TG +P    +   A  D++ + L      L   D      +   +
Sbjct: 172 FSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKN 231

Query: 316 YSLTMSNKGTEIEYLKLSNLIAAIIISDKNFVGEIPTSISSLKGLRTLSLSNNNLRGGAI 375
                  K    + L   +L       +    G +P  ++ LK L +L++S NNL G  I
Sbjct: 232 SLAFDLGKVGLSKNLNGLDL------RNNRIYGTLPQGLTQLKFLHSLNVSFNNLCG-EI 284

Query: 376 PQGTQFSTFTNDWFAGNPGLCGEPLS 401
           PQG     F    +A N  LCG PL 
Sbjct: 285 PQGGNLQRFDVSAYANNKCLCGSPLP 310
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.99
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.57
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.29
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.93  E-value=6.5e-24  Score=221.94  Aligned_cols=194  Identities=26%  Similarity=0.373  Sum_probs=151.8

Q ss_pred             ccccccccCCeeEecccccCCCchhhhhcCCCCcEEeccCCcccccccccccccCCCcEEEeeCCcCCCCccccccCCcc
Q 037679          466 PQFQKSSLLEDLRLSYTRFSGKIPDSIENLESLSYLGISDCSFIGKIPSSLFNLTKLEHLYLSGNRFLDELPTSIGNLAS  545 (693)
Q Consensus       466 ~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~l~~  545 (693)
                      ..+..++.++.++++++.+.+..  .+..+++|+.|++.+|.++..  ..+..+++|+.+++++|.+.+..  .+..+++
T Consensus       191 ~~~~~l~~~~~l~l~~n~i~~~~--~~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~  264 (384)
T d2omza2         191 SVLAKLTNLESLIATNNQISDIT--PLGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLA--PLSGLTK  264 (384)
T ss_dssp             GGGGGCTTCSEEECCSSCCCCCG--GGGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCG--GGTTCTT
T ss_pred             cccccccccceeeccCCccCCCC--cccccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCCC--ccccccc
Confidence            34556667777778777777543  245667888888888876643  35778888999999998875543  3677889


Q ss_pred             ccEEEecCccccccchhccCCCCCCcEEecccCCCCccccchhHhhhcCCCCcEEEccCCCCCCcccccccCCCCCCEEE
Q 037679          546 LKALEISSFNFSSTLQASLGNLTQLDSLTISNSNFSRLMSSSLSWLTNLNQLTSLNFPYCNLNNEIPFGISNLTQLTALD  625 (693)
Q Consensus       546 L~~L~l~~~~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~  625 (693)
                      |+.|+++++.+.+..  .+..++.++.+.++.|.+....     .+..++++++|++++|++++..  .+..+++|++|+
T Consensus       265 L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~-----~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~  335 (384)
T d2omza2         265 LTELKLGANQISNIS--PLAGLTALTNLELNENQLEDIS-----PISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLF  335 (384)
T ss_dssp             CSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCG-----GGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEE
T ss_pred             CCEeeccCcccCCCC--cccccccccccccccccccccc-----ccchhcccCeEECCCCCCCCCc--ccccCCCCCEEE
Confidence            999999988877643  4678888999999998877532     3567889999999999998653  378899999999


Q ss_pred             ccCCccCCCccccccCcCcccEEeccCccCCCCcchhhcCCCCCCeEEccCCc
Q 037679          626 LSYNQLTGPIPYSLMKLKKVSSLLLGFNQLSGRIPVEISNLTQLQSLQLSSNQ  678 (693)
Q Consensus       626 l~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~  678 (693)
                      +++|++++ ++ .+.++++|+.|++++|++++..|  +.++++|++|+|++|.
T Consensus       336 L~~n~l~~-l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~Na  384 (384)
T d2omza2         336 FANNKVSD-VS-SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQA  384 (384)
T ss_dssp             CCSSCCCC-CG-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCEE
T ss_pred             CCCCCCCC-Ch-hHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCCc
Confidence            99999984 44 58889999999999999985443  7899999999999884
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure