Citrus Sinensis ID: 037696

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MAQLPPKIPNMSHNWSSFPYQRMSFISSNNNNNNDNNNNNIANAATTMTLNNNNNIHHNQPHWVDEFLDFSSVRRGAHRRSISDSVAFLDPPSSLVVVEECRNSNNSNNNNNNSTMNNIMSSSDANYCFDRLDDEQLMSMFSDDISVSVPPTASSSNPSTPSDQNSNNDEKVTAPSDQQQQQKQQQQQPKNEPGEVESSCKNNEPSSSQTTTHQTPPASNGDTIIDPKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVAFLDHQRLILNVDNSALKQRIAALAQDKIFKDAHQEALKKEIERLRQVYHQQNIKKMKNNNNSNNNATPPPQQPPSQPMNTDTIVCMDKDQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc
*AQLPPKIPNMSHNWS**********************************************WVDEFLDFSS******************************************************YCF*******************************************************************************************************************VRKLQYISELERSVTTLQTEVSALSPRVAFLDHQRLILNVDNSALKQRIAALAQDKIFKDAHQ*ALKKEIE************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQLPPKIPNMSHNWSSFPYQRMSFISSNNNNNNDNNNNNIANAATTMTLNNNNNIHHNQPHWVDEFLDFSSVRRGAHRRSISDSVAFLDPPSSLVVVEECRNSNNSNNNNNNSTMNNIMSSSDANYCFDRLDDEQLMSMFSDDISVSVPPTASSSNPSTPSDQNSNNDEKVTAPSDQQQQQKQQQQQPKNEPGEVESSCKNNEPSSSQTTTHQTPPASNGDTIIDPKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVAFLDHQRLILNVDNSALKQRIAALAQDKIFKDAHxxxxxxxxxxxxxxxxxxxxxKMKNNNNSNNNATPPPQQPPSQPMNTDTIVCMDKDQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T2K, chain D
Confidence level:confident
Coverage over the Query: 228-293
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 238-323
View the alignment between query and template
View the model in PyMOL