Citrus Sinensis ID: 037779

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310

MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVERYANRSD

cccccEEEEccccccccccccccHHHHHHHHHHHcccEEEECccHHHHHHHHHHccEEEEEcccccHHHHHcccccccccHHHHHHHHHccccccEEccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccCEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccHHHHHcccc

****GVVTVYGNGA*****KKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVERY*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pyridoxal biosynthesis lyase PdxS	Involved in the production of pyridoxal phosphate, probably by incorporating ammonia into the pyridine ring.	confident	A9WFT9
Pyridoxal biosynthesis lyase PdxS	Involved in the production of pyridoxal phosphate, probably by incorporating ammonia into the pyridine ring.	confident	P60800
Pyridoxal biosynthesis lyase PdxS	Involved in the production of pyridoxal phosphate, probably by incorporating ammonia into the pyridine ring.	confident	A9B891

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NV1, chain A
Confidence level:very confident
Coverage over the Query: 23-288
View the alignment between query and template
View the model in PyMOL