Citrus Sinensis ID: 037779


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVERYANRSD
cccccEEEEccccccccccccccHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccEEEEEcccccHHHHHHccccccccHHHHHHHHHccccccEEccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccHHHHHcccc
ccccEEEEEEcccccccccccccHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccEEccccccccccccccccccccEccEEcccccHHHHHHHHHHccHEEEccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHccccEEEcccEEccccHHHHHHHHHHHHHccccHHHHHHHHccccccccccEcccccHHHHHHccc
MADTGVVTVYGngaiyettkkspfsVKVGLAQMLrggvimdvvTPEQARIAEEAGACAVMALErvpadiraqggvarmsdpqlIKQIKSSVTIPVMAKARIGHFVEAQILEAIgvdyvdesevltpadeenhinkhnfrvpfvcgcrnlGESLRRIREGAAMIRtkgeagtgNIVEAVRHVRSVMGDIrvlrnmdddevFTFAkniaapydLVMQTkqlgrlpvvhfaaggvatpaDAAMMMQLGCDgvfvgsgvfksgdpVRRARAIVQAVtnysdpdvlAEVSCglgeamvgidlndvkveryanrsd
madtgvvtvygngaiyettkkspfsVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGgvarmsdpqliKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPAdeenhinkhnfrvpfVCGCRNLGESLRRIREGAAmirtkgeagtgniveaVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQavtnysdpdvLAEVSCGLGEamvgidlndvkveryanrsd
MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFaaggvatpadaaMMMQLGCDgvfvgsgvfksgDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVERYANRSD
****GVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVE*******
****GVV******************VKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKV*RY*****
MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVERYANRSD
***TGVVTVYGNGA*****KKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVER******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVERYANRSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query310 2.2.26 [Sep-21-2011]
Q39963309 Probable pyridoxal biosyn N/A no 0.996 1.0 0.925 1e-167
Q8L940309 Pyridoxal biosynthesis pr yes no 0.996 1.0 0.887 1e-160
Q9FT25312 Pyridoxal biosynthesis pr N/A no 0.980 0.974 0.895 1e-158
O80448309 Pyridoxal biosynthesis pr no no 0.996 1.0 0.864 1e-155
Q69LA6318 Probable pyridoxal biosyn yes no 0.990 0.965 0.859 1e-152
Q9AT63309 Probable pyridoxal biosyn N/A no 0.996 1.0 0.845 1e-151
Q8W3D0313 Probable pyridoxal biosyn no no 0.987 0.977 0.847 1e-147
B8G663293 Pyridoxal biosynthesis ly yes no 0.932 0.986 0.757 1e-130
B9LIK3293 Pyridoxal biosynthesis ly yes no 0.932 0.986 0.757 1e-130
A9WFT9293 Pyridoxal biosynthesis ly yes no 0.932 0.986 0.757 1e-130
>sp|Q39963|PDX1_HEVBR Probable pyridoxal biosynthesis protein PDX1 OS=Hevea brasiliensis GN=PDX1 PE=2 SV=1 Back     alignment and function desciption
 Score =  586 bits (1511), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/310 (92%), Positives = 300/310 (96%), Gaps = 1/310 (0%)

Query: 1   MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVM 60
           MA TGVV VYGNGAI ET KKSPFSVKVGLAQMLRGGVIMDVV PEQARIAEEAGACAVM
Sbjct: 1   MAGTGVVAVYGNGAITET-KKSPFSVKVGLAQMLRGGVIMDVVNPEQARIAEEAGACAVM 59

Query: 61  ALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDE 120
           ALERVPADIRAQGGVARMSDPQLIK+IK SVTIPVMAKARIGHFVEAQILEAIG+DYVDE
Sbjct: 60  ALERVPADIRAQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDE 119

Query: 121 SEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRH 180
           SEVLTPADEENHINKHNFR+PFVCGCRNLGE+LRRIREGAAMIRTKGEAGTGN++EAVRH
Sbjct: 120 SEVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNVIEAVRH 179

Query: 181 VRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAM 240
           VRSVMGDIR+LRNMDDDEVFTFAK IAAPYDLVMQTKQLGRLPVV FAAGGVATPADAA+
Sbjct: 180 VRSVMGDIRLLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL 239

Query: 241 MMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDV 300
           MMQLGCDGVFVGSGVFKSGDP RRARAIVQAVT+YSDPD+LAEVSCGLGEAMVGI+LND 
Sbjct: 240 MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPDMLAEVSCGLGEAMVGINLNDK 299

Query: 301 KVERYANRSD 310
           KVER+ANRS+
Sbjct: 300 KVERFANRSE 309




Involved in the production of pyridoxal (vitamin B6) and indirect resistance to singlet oxygen-generating photosensitizers.
Hevea brasiliensis (taxid: 3981)
>sp|Q8L940|PDX13_ARATH Pyridoxal biosynthesis protein PDX1.3 OS=Arabidopsis thaliana GN=PDX13 PE=1 SV=2 Back     alignment and function description
>sp|Q9FT25|PDX1_PHAVU Pyridoxal biosynthesis protein PDX1 OS=Phaseolus vulgaris GN=PDX1 PE=2 SV=1 Back     alignment and function description
>sp|O80448|PDX11_ARATH Pyridoxal biosynthesis protein PDX1.1 OS=Arabidopsis thaliana GN=PDX11 PE=1 SV=1 Back     alignment and function description
>sp|Q69LA6|PDX11_ORYSJ Probable pyridoxal biosynthesis protein PDX1.1 OS=Oryza sativa subsp. japonica GN=PDX11 PE=2 SV=1 Back     alignment and function description
>sp|Q9AT63|PDX1_GINBI Probable pyridoxal biosynthesis protein PDX1 OS=Ginkgo biloba GN=PDX1 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3D0|PDX12_ORYSJ Probable pyridoxal biosynthesis protein PDX1.2 OS=Oryza sativa subsp. japonica GN=PDX12 PE=2 SV=1 Back     alignment and function description
>sp|B8G663|PDXS_CHLAD Pyridoxal biosynthesis lyase PdxS OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pdxS PE=3 SV=1 Back     alignment and function description
>sp|B9LIK3|PDXS_CHLSY Pyridoxal biosynthesis lyase PdxS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pdxS PE=3 SV=1 Back     alignment and function description
>sp|A9WFT9|PDXS_CHLAA Pyridoxal biosynthesis lyase PdxS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pdxS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
2501578309 RecName: Full=Probable pyridoxal biosynt 0.996 1.0 0.925 1e-165
224139104309 predicted protein [Populus trichocarpa] 0.996 1.0 0.916 1e-164
255569365327 Pyridoxin biosynthesis protein PDX1, put 0.980 0.929 0.927 1e-164
225434584309 PREDICTED: probable pyridoxal biosynthes 0.996 1.0 0.916 1e-163
224087752309 predicted protein [Populus trichocarpa] 0.996 1.0 0.906 1e-161
46399269309 putative pyridoxine biosynthesis protein 0.996 1.0 0.893 1e-161
72256517310 pyridoxine biosynthesis protein [Lotus j 1.0 1.0 0.896 1e-161
356549200311 PREDICTED: pyridoxal biosynthesis protei 0.987 0.983 0.912 1e-160
351723277311 pyridoxine biosynthesis protein [Glycine 0.987 0.983 0.908 1e-160
395146546 801 hypothetical protein [Linum usitatissimu 0.980 0.379 0.904 1e-159
>gi|2501578|sp|Q39963.1|PDX1_HEVBR RecName: Full=Probable pyridoxal biosynthesis protein PDX1; AltName: Full=Ethylene-inducible protein HEVER gi|1209317|gb|AAA91063.1| ethylene-inducible protein [Hevea brasiliensis] Back     alignment and taxonomy information
 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/310 (92%), Positives = 300/310 (96%), Gaps = 1/310 (0%)

Query: 1   MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVM 60
           MA TGVV VYGNGAI ET KKSPFSVKVGLAQMLRGGVIMDVV PEQARIAEEAGACAVM
Sbjct: 1   MAGTGVVAVYGNGAITET-KKSPFSVKVGLAQMLRGGVIMDVVNPEQARIAEEAGACAVM 59

Query: 61  ALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDE 120
           ALERVPADIRAQGGVARMSDPQLIK+IK SVTIPVMAKARIGHFVEAQILEAIG+DYVDE
Sbjct: 60  ALERVPADIRAQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDE 119

Query: 121 SEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRH 180
           SEVLTPADEENHINKHNFR+PFVCGCRNLGE+LRRIREGAAMIRTKGEAGTGN++EAVRH
Sbjct: 120 SEVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNVIEAVRH 179

Query: 181 VRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAM 240
           VRSVMGDIR+LRNMDDDEVFTFAK IAAPYDLVMQTKQLGRLPVV FAAGGVATPADAA+
Sbjct: 180 VRSVMGDIRLLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL 239

Query: 241 MMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDV 300
           MMQLGCDGVFVGSGVFKSGDP RRARAIVQAVT+YSDPD+LAEVSCGLGEAMVGI+LND 
Sbjct: 240 MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPDMLAEVSCGLGEAMVGINLNDK 299

Query: 301 KVERYANRSD 310
           KVER+ANRS+
Sbjct: 300 KVERFANRSE 309




Source: Hevea brasiliensis

Species: Hevea brasiliensis

Genus: Hevea

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224139104|ref|XP_002322981.1| predicted protein [Populus trichocarpa] gi|222867611|gb|EEF04742.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255569365|ref|XP_002525650.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis] gi|223535086|gb|EEF36768.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225434584|ref|XP_002278391.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224087752|ref|XP_002308219.1| predicted protein [Populus trichocarpa] gi|222854195|gb|EEE91742.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|46399269|gb|AAS92255.1| putative pyridoxine biosynthesis protein isoform A [Nicotiana tabacum] gi|46399271|gb|AAS92256.1| putative pyridoxine biosynthesis protein isoform B [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|72256517|gb|AAZ67141.1| pyridoxine biosynthesis protein [Lotus japonicus] Back     alignment and taxonomy information
>gi|356549200|ref|XP_003542985.1| PREDICTED: pyridoxal biosynthesis protein PDX1-like [Glycine max] Back     alignment and taxonomy information
>gi|351723277|ref|NP_001238041.1| pyridoxine biosynthesis protein [Glycine max] gi|72256519|gb|AAZ67142.1| pyridoxine biosynthesis protein [Glycine max] Back     alignment and taxonomy information
>gi|395146546|gb|AFN53699.1| hypothetical protein [Linum usitatissimum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
TAIR|locus:2179142309 RSR4 "REDUCED SUGAR RESPONSE 4 0.996 1.0 0.812 1.2e-129
TAIR|locus:2042932309 PDX1.1 "pyridoxine biosynthesi 0.996 1.0 0.787 4.3e-125
DICTYBASE|DDB_G0288299305 pdx1 "vitamin B6 biosynthesis 0.941 0.957 0.643 1.2e-95
POMBASE|SPAC29B12.04296 snz1 "pyridoxine biosynthesis 0.929 0.972 0.657 2e-95
TIGR_CMR|CHY_2703294 CHY_2703 "pyridoxine biosynthe 0.932 0.982 0.658 8.7e-95
UNIPROTKB|Q3Z9H3293 pdxS "Pyridoxal biosynthesis l 0.919 0.972 0.628 1.9e-92
TIGR_CMR|DET_0380293 DET_0380 "pyridoxine biosynthe 0.919 0.972 0.628 1.9e-92
ASPGD|ASPL0000069714304 pyroA [Emericella nidulans (ta 0.919 0.937 0.643 3e-92
TAIR|locus:2093427314 PDX1.2 "pyridoxine biosynthesi 0.977 0.964 0.555 7.5e-89
UNIPROTKB|P60796299 pdxS "Pyridoxal biosynthesis l 0.912 0.946 0.616 5.4e-86
TAIR|locus:2179142 RSR4 "REDUCED SUGAR RESPONSE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1272 (452.8 bits), Expect = 1.2e-129, P = 1.2e-129
 Identities = 252/310 (81%), Positives = 270/310 (87%)

Query:     1 MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVM 60
             M  TGVV VYGNGAI E  KKSPFSVKVGLAQMLRGGVIMDVV  EQARIAEEAGACAVM
Sbjct:     1 MEGTGVVAVYGNGAITEA-KKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM 59

Query:    61 ALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDE 120
             ALERVPADIRAQGGVARMSDPQ+IK+IK +VTIPVMAKARIGHFVEAQILEAIG+DY+DE
Sbjct:    60 ALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDE 119

Query:   121 SEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRH 180
             SEVLT ADE++HINKHNFR+PFVCGCRNLGE+LRRIREGAAMIRTKGEAGTGNI+EAVRH
Sbjct:   120 SEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRH 179

Query:   181 VRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFXXXXXXXXXXXXM 240
             VRSV GDIRVLRNMDDDEVFTFAK +AAPYDLVMQTKQLGRLPVV F            +
Sbjct:   180 VRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL 239

Query:   241 MMQLGCDXXXXXXXXXXXXDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDV 300
             MMQLGCD            DP RRARAIVQAVT+YSDP++L EVSCGLGEAMVGI+LND 
Sbjct:   240 MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINLNDE 299

Query:   301 KVERYANRSD 310
             KVER+ANRS+
Sbjct:   300 KVERFANRSE 309




GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0042823 "pyridoxal phosphate biosynthetic process" evidence=IEA
GO:0010224 "response to UV-B" evidence=IGI
GO:0005829 "cytosol" evidence=IDA
GO:0042819 "vitamin B6 biosynthetic process" evidence=IGI;RCA
GO:0005886 "plasma membrane" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0006982 "response to lipid hydroperoxide" evidence=IMP
GO:0008615 "pyridoxine biosynthetic process" evidence=IGI
GO:0012505 "endomembrane system" evidence=IDA
GO:0042538 "hyperosmotic salinity response" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0006520 "cellular amino acid metabolic process" evidence=IMP
GO:0015994 "chlorophyll metabolic process" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0009651 "response to salt stress" evidence=IMP
GO:0010335 "response to non-ionic osmotic stress" evidence=IMP
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TAIR|locus:2042932 PDX1.1 "pyridoxine biosynthesis 1.1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288299 pdx1 "vitamin B6 biosynthesis protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC29B12.04 snz1 "pyridoxine biosynthesis protein" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2703 CHY_2703 "pyridoxine biosynthesis protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q3Z9H3 pdxS "Pyridoxal biosynthesis lyase PdxS" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0380 DET_0380 "pyridoxine biosynthesis protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
ASPGD|ASPL0000069714 pyroA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2093427 PDX1.2 "pyridoxine biosynthesis 1.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P60796 pdxS "Pyridoxal biosynthesis lyase PdxS" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A0QWG8PDXS_MYCS24, ., -, ., -, ., -0.69360.91290.9339yesno
Q5NHE6PDXS_FRATT4, ., -, ., -, ., -0.68290.91610.9895yesno
Q3ZZB8PDXS_DEHSC4, ., -, ., -, ., -0.69820.91930.9726yesno
A9WFT9PDXS_CHLAA4, ., -, ., -, ., -0.75770.93220.9863yesno
P60800PDXS_CORDI4, ., -, ., -, ., -0.70420.91290.9528yesno
Q6AFB9PDXS_LEIXX4, ., -, ., -, ., -0.68360.93870.9732yesno
A9B891PDXS_HERA24, ., -, ., -, ., -0.74020.90640.9590yesno
Q69LA6PDX11_ORYSJNo assigned EC number0.85940.99030.9654yesno
A5U5V7PDXS_MYCTA4, ., -, ., -, ., -0.69010.91290.9464yesno
A5UY94PDXS_ROSS14, ., -, ., -, ., -0.78570.90320.9556yesno
B2SDL5PDXS_FRATM4, ., -, ., -, ., -0.68290.91610.9895yesno
Q97LG7PDXS_CLOAB4, ., -, ., -, ., -0.69170.89670.9553yesno
B0K4N7PDXS_THEPX4, ., -, ., -, ., -0.68530.91930.9760yesno
B0TAQ4PDXS_HELMI4, ., -, ., -, ., -0.71080.92580.9728yesno
A7NQB8PDXS_ROSCS4, ., -, ., -, ., -0.77850.90320.9556yesno
A0Q5I1PDXS_FRATN4, ., -, ., -, ., -0.68290.91610.9895yesno
Q73WF0PDXS_MYCPA4, ., -, ., -, ., -0.69010.91290.9339N/Ano
A7NDQ3PDXS_FRATF4, ., -, ., -, ., -0.68290.91610.9895yesno
A1KLV6PDXS_MYCBP4, ., -, ., -, ., -0.69010.91290.9464yesno
Q14IU8PDXS_FRAT14, ., -, ., -, ., -0.68290.91610.9895yesno
B8I363PDXS_CLOCE4, ., -, ., -, ., -0.65730.91930.9760yesno
B2A2Z7PDXS_NATTJ4, ., -, ., -, ., -0.71370.93220.9796yesno
P60796PDXS_MYCTU4, ., -, ., -, ., -0.69010.91290.9464yesno
Q9AT63PDX1_GINBINo assigned EC number0.84510.99671.0N/Ano
O14027PDX1_SCHPONo assigned EC number0.73350.92900.9729yesno
B9LIK3PDXS_CHLSY4, ., -, ., -, ., -0.75770.93220.9863yesno
Q9UW83PDX1_EMENINo assigned EC number0.73070.90320.9210yesno
B0KAS1PDXS_THEP34, ., -, ., -, ., -0.68180.91930.9760yesno
Q9FT25PDX1_PHAVUNo assigned EC number0.89540.98060.9743N/Ano
O80448PDX11_ARATHNo assigned EC number0.86450.99671.0nono
Q2A260PDXS_FRATH4, ., -, ., -, ., -0.68290.91610.9895yesno
Q0BKT2PDXS_FRATO4, ., -, ., -, ., -0.68290.91610.9895yesno
Q72KG1PDXS_THET24, ., -, ., -, ., -0.71030.93220.9863yesno
Q8W3D0PDX12_ORYSJNo assigned EC number0.84780.98700.9776nono
B8J2D5PDXS_DESDA4, ., -, ., -, ., -0.71120.91290.9658yesno
O59905PDX1_CERNCNo assigned EC number0.70580.92900.8396N/Ano
Q8L940PDX13_ARATHNo assigned EC number0.88700.99671.0yesno
A4IZB5PDXS_FRATW4, ., -, ., -, ., -0.68290.91610.9895yesno
Q8RBJ3PDXS_THETN4, ., -, ., -, ., -0.68180.91930.9760yesno
Q54J47PDX1_DICDINo assigned EC number0.72260.94190.9573yesno
B8G663PDXS_CHLAD4, ., -, ., -, ., -0.75770.93220.9863yesno
Q5SKD9PDXS_THET84, ., -, ., -, ., -0.71030.93220.9863yesno
P60795PDXS_MYCBO4, ., -, ., -, ., -0.69010.91290.9464yesno
A0QIC8PDXS_MYCA14, ., -, ., -, ., -0.69010.91290.9339yesno
C1AF77PDXS_MYCBT4, ., -, ., -, ., -0.69010.91290.9464yesno
Q3Z9H3PDXS_DEHE14, ., -, ., -, ., -0.70520.91930.9726yesno
Q39963PDX1_HEVBRNo assigned EC number0.92580.99671.0N/Ano
Q8WPW2PDX1_SUBDONo assigned EC number0.64480.93220.9444N/Ano
B0TZ17PDXS_FRAP24, ., -, ., -, ., -0.67240.91610.9895yesno
A5FS82PDXS_DEHSB4, ., -, ., -, ., -0.69820.91930.9726yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
PRK04180293 PRK04180, PRK04180, pyridoxal biosynthesis lyase P 0.0
cd04727283 cd04727, pdxS, PdxS is a subunit of the pyridoxal 0.0
COG0214296 COG0214, SNZ1, Pyridoxine biosynthesis enzyme [Coe 0.0
TIGR00343287 TIGR00343, TIGR00343, pyridoxal 5'-phosphate synth 1e-163
pfam01680197 pfam01680, SOR_SNZ, SOR/SNZ family 1e-129
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 8e-08
cd04728248 cd04728, ThiG, Thiazole synthase (ThiG) is the tet 2e-07
COG2022262 COG2022, ThiG, Uncharacterized enzyme of thiazole 2e-07
PRK00208250 PRK00208, thiG, thiazole synthase; Reviewed 3e-07
pfam05690246 pfam05690, ThiG, Thiazole biosynthesis protein Thi 4e-07
PRK11840326 PRK11840, PRK11840, bifunctional sulfur carrier pr 7e-07
CHL00162267 CHL00162, thiG, thiamin biosynthesis protein G; Va 1e-04
cd00564196 cd00564, TMP_TenI, Thiamine monophosphate synthase 2e-04
cd04730236 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD 4e-04
COG0042323 COG0042, COG0042, tRNA-dihydrouridine synthase [Tr 4e-04
PRK00043212 PRK00043, thiE, thiamine-phosphate pyrophosphoryla 5e-04
PRK07565334 PRK07565, PRK07565, dihydroorotate dehydrogenase 2 0.001
cd02801231 cd02801, DUS_like_FMN, Dihydrouridine synthase-lik 0.002
COG0042323 COG0042, COG0042, tRNA-dihydrouridine synthase [Tr 0.003
COG0352211 COG0352, ThiE, Thiamine monophosphate synthase [Co 0.003
cd04729219 cd04729, NanE, N-acetylmannosamine-6-phosphate epi 0.003
TIGR00737319 TIGR00737, nifR3_yhdG, putative TIM-barrel protein 0.003
cd02801231 cd02801, DUS_like_FMN, Dihydrouridine synthase-lik 0.004
>gnl|CDD|179769 PRK04180, PRK04180, pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
 Score =  572 bits (1478), Expect = 0.0
 Identities = 210/284 (73%), Positives = 249/284 (87%), Gaps = 1/284 (0%)

Query: 26  VKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIK 85
           VK G A+ML+GGVIMDVV  EQA+IAEEAGA AVMALERVPADIRA GGVARM+DP++I+
Sbjct: 8   VKRGFAEMLKGGVIMDVVNAEQAKIAEEAGAVAVMALERVPADIRAAGGVARMADPKMIE 67

Query: 86  QIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCG 145
           +I  +V+IPVMAKARIGHFVEAQILEA+GVDY+DESEVLTPADEE HI+K +F VPFVCG
Sbjct: 68  EIMDAVSIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADEEYHIDKWDFTVPFVCG 127

Query: 146 CRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKN 205
            RNLGE+LRRI EGAAMIRTKGEAGTGN+VEAVRH+R + G+IR L +M +DE++T AK 
Sbjct: 128 ARNLGEALRRIAEGAAMIRTKGEAGTGNVVEAVRHMRQINGEIRRLTSMSEDELYTAAKE 187

Query: 206 IAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRA 265
           + APY+LV +  +LGRLPVV+FAAGG+ATPADAA+MMQLG DGVFVGSG+FKSGDP +RA
Sbjct: 188 LQAPYELVKEVAELGRLPVVNFAAGGIATPADAALMMQLGADGVFVGSGIFKSGDPEKRA 247

Query: 266 RAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKV-ERYANR 308
           RAIV+A T+Y DP+VLAEVS GLGEAMVGID++++   ER   R
Sbjct: 248 RAIVEATTHYDDPEVLAEVSKGLGEAMVGIDIDELPPEERLQER 291


Length = 293

>gnl|CDD|240078 cd04727, pdxS, PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>gnl|CDD|223292 COG0214, SNZ1, Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|129443 TIGR00343, TIGR00343, pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>gnl|CDD|201920 pfam01680, SOR_SNZ, SOR/SNZ family Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|240079 cd04728, ThiG, Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>gnl|CDD|224933 COG2022, ThiG, Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|234687 PRK00208, thiG, thiazole synthase; Reviewed Back     alignment and domain information
>gnl|CDD|147701 pfam05690, ThiG, Thiazole biosynthesis protein ThiG Back     alignment and domain information
>gnl|CDD|236998 PRK11840, PRK11840, bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>gnl|CDD|214380 CHL00162, thiG, thiamin biosynthesis protein G; Validated Back     alignment and domain information
>gnl|CDD|238317 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>gnl|CDD|240081 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>gnl|CDD|223120 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234590 PRK00043, thiE, thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>gnl|CDD|236051 PRK07565, PRK07565, dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>gnl|CDD|239200 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>gnl|CDD|223120 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|223429 COG0352, ThiE, Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|240080 cd04729, NanE, N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>gnl|CDD|129820 TIGR00737, nifR3_yhdG, putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>gnl|CDD|239200 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 310
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 100.0
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 100.0
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 100.0
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 100.0
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 100.0
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 100.0
PLN02460338 indole-3-glycerol-phosphate synthase 100.0
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 100.0
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 100.0
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 99.98
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 99.98
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 99.97
PF01680208 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p 99.96
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 99.96
KOG4201289 consensus Anthranilate synthase component II [Amin 99.95
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.88
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 99.85
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 99.82
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 99.75
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 99.74
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 99.73
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 99.7
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 99.69
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.68
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 99.68
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.67
PRK14024241 phosphoribosyl isomerase A; Provisional 99.67
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 99.66
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.65
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.65
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 99.65
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 99.64
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.64
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 99.64
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 99.61
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.61
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 99.6
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 99.59
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 99.59
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 99.59
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 99.59
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 99.58
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.58
PRK00208250 thiG thiazole synthase; Reviewed 99.58
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 99.58
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 99.57
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 99.57
PRK07695201 transcriptional regulator TenI; Provisional 99.56
CHL00162267 thiG thiamin biosynthesis protein G; Validated 99.56
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 99.55
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 99.54
PLN02334229 ribulose-phosphate 3-epimerase 99.52
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 99.51
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 99.51
PLN02617538 imidazole glycerol phosphate synthase hisHF 99.5
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 99.5
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 99.49
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.49
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.49
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 99.48
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.48
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 99.48
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 99.46
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 99.46
PRK04302223 triosephosphate isomerase; Provisional 99.46
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 99.45
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 99.45
PRK05581220 ribulose-phosphate 3-epimerase; Validated 99.44
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 99.43
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 99.43
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 99.41
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 99.41
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 99.41
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 99.4
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 99.4
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 99.4
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 99.4
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 99.39
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 99.39
PRK08999312 hypothetical protein; Provisional 99.38
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 99.37
PLN02591250 tryptophan synthase 99.37
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 99.34
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 99.32
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 99.31
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 99.29
PRK08005210 epimerase; Validated 99.28
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 99.28
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 99.28
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 99.26
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 99.25
PRK08091228 ribulose-phosphate 3-epimerase; Validated 99.25
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 99.25
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 99.24
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 99.24
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 99.24
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 99.23
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 99.22
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 99.22
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 99.21
PRK14057254 epimerase; Provisional 99.21
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 99.2
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 99.19
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 99.18
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 99.18
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 99.18
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 99.17
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 99.16
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 99.16
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.15
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 99.14
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 99.14
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.13
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 99.13
PLN02274505 inosine-5'-monophosphate dehydrogenase 99.12
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 99.12
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 99.12
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 99.1
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.1
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 99.09
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 99.09
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 99.08
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.08
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 99.05
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 99.03
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 99.03
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 99.02
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 99.01
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 98.99
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 98.99
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 98.98
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.98
PRK07226267 fructose-bisphosphate aldolase; Provisional 98.98
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 98.97
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 98.97
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 98.96
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 98.96
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 98.96
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 98.95
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 98.94
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.93
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 98.92
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.89
PRK06806281 fructose-bisphosphate aldolase; Provisional 98.89
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.88
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 98.86
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.86
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.85
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 98.81
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 98.8
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 98.76
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 98.75
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 98.73
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 98.72
PRK07315293 fructose-bisphosphate aldolase; Provisional 98.71
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 98.67
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 98.65
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 98.65
PRK08227264 autoinducer 2 aldolase; Validated 98.64
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 98.61
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 98.61
PRK06852304 aldolase; Validated 98.59
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 98.59
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 98.55
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 98.53
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 98.52
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 98.51
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 98.48
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 98.47
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 98.47
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 98.46
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 98.43
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 98.42
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 98.41
PLN02535364 glycolate oxidase 98.4
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 98.39
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 98.39
KOG0623541 consensus Glutamine amidotransferase/cyclase [Amin 98.36
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 98.36
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 98.35
PLN02826409 dihydroorotate dehydrogenase 98.35
PRK13523337 NADPH dehydrogenase NamA; Provisional 98.35
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 98.33
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 98.33
PLN02979366 glycolate oxidase 98.33
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 98.31
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 98.3
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 98.29
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 98.29
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 98.29
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 98.28
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 98.28
PRK06801286 hypothetical protein; Provisional 98.28
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 98.26
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 98.25
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 98.17
PRK11197381 lldD L-lactate dehydrogenase; Provisional 98.16
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 98.16
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 98.16
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 98.11
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.1
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 98.1
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.07
PRK09250348 fructose-bisphosphate aldolase; Provisional 98.07
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 98.06
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 98.06
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 98.05
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.05
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 98.02
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 98.02
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.01
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 97.98
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 97.94
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 97.91
TIGR01334277 modD putative molybdenum utilization protein ModD. 97.91
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 97.89
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 97.89
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 97.86
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 97.85
PRK08185283 hypothetical protein; Provisional 97.85
COG1411229 Uncharacterized protein related to proFAR isomeras 97.84
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 97.84
KOG0538363 consensus Glycolate oxidase [Energy production and 97.83
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 97.82
cd02812219 PcrB_like PcrB_like proteins. One member of this f 97.8
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 97.79
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 97.78
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 97.78
PRK09016296 quinolinate phosphoribosyltransferase; Validated 97.77
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 97.74
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 97.72
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 97.69
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 97.67
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 97.66
PRK06096284 molybdenum transport protein ModD; Provisional 97.64
PRK00507221 deoxyribose-phosphate aldolase; Provisional 97.63
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 97.63
PLN02363256 phosphoribosylanthranilate isomerase 97.62
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 97.62
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 97.61
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 97.59
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.58
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.56
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 97.54
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.52
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 97.52
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 97.5
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 97.49
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.45
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.42
PRK11572248 copper homeostasis protein CutC; Provisional 97.41
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.4
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 97.38
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.37
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.37
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 97.35
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 97.35
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 97.33
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.33
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 97.3
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 97.29
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.28
PRK14024241 phosphoribosyl isomerase A; Provisional 97.28
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 97.21
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.2
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.19
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 97.18
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 97.18
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.17
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 97.16
PLN02617 538 imidazole glycerol phosphate synthase hisHF 97.16
PF00697197 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome 97.15
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 97.14
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.14
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 97.14
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 97.12
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.11
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 97.11
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 97.1
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.1
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 97.1
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 97.1
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 97.08
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.06
PF01645368 Glu_synthase: Conserved region in glutamate syntha 97.06
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 97.02
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 97.01
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 96.99
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 96.98
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 96.96
PRK10605362 N-ethylmaleimide reductase; Provisional 96.94
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 96.93
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 96.93
PRK07709285 fructose-bisphosphate aldolase; Provisional 96.93
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 96.91
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 96.9
PRK12656222 fructose-6-phosphate aldolase; Reviewed 96.89
PRK08610286 fructose-bisphosphate aldolase; Reviewed 96.88
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 96.87
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 96.87
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 96.86
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 96.85
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 96.85
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 96.84
PRK05096 346 guanosine 5'-monophosphate oxidoreductase; Provisi 96.8
TIGR00875213 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ 96.79
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 96.77
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 96.77
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 96.77
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 96.76
PRK01362214 putative translaldolase; Provisional 96.75
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 96.74
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 96.74
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 96.73
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.72
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 96.7
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 96.68
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 96.63
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 96.56
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 96.55
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.54
PRK00042250 tpiA triosephosphate isomerase; Provisional 96.54
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 96.5
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 96.49
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 96.48
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 96.48
PRK07084321 fructose-bisphosphate aldolase; Provisional 96.46
PRK14565237 triosephosphate isomerase; Provisional 96.46
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 96.43
PRK05283257 deoxyribose-phosphate aldolase; Provisional 96.42
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 96.4
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 96.39
PRK02227238 hypothetical protein; Provisional 96.38
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 96.38
KOG2333614 consensus Uncharacterized conserved protein [Gener 96.37
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 96.37
PLN02979366 glycolate oxidase 96.35
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 96.34
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 96.32
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.3
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 96.28
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 96.26
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 96.25
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 96.22
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 96.19
PRK00208250 thiG thiazole synthase; Reviewed 96.18
PRK11197381 lldD L-lactate dehydrogenase; Provisional 96.1
PF00215226 OMPdecase: Orotidine 5'-phosphate decarboxylase / 96.1
CHL00162267 thiG thiamin biosynthesis protein G; Validated 96.09
PRK05835307 fructose-bisphosphate aldolase; Provisional 96.04
PRK12653220 fructose-6-phosphate aldolase; Reviewed 96.04
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 96.04
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 95.99
PRK14567253 triosephosphate isomerase; Provisional 95.98
COG3142241 CutC Uncharacterized protein involved in copper re 95.96
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 95.95
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 95.91
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 95.9
PRK12655220 fructose-6-phosphate aldolase; Reviewed 95.85
PTZ00333255 triosephosphate isomerase; Provisional 95.84
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 95.83
COG0191286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 95.8
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.79
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 95.77
PLN02429315 triosephosphate isomerase 95.68
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 95.68
PRK12376236 putative translaldolase; Provisional 95.67
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 95.65
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 95.64
PLN02274505 inosine-5'-monophosphate dehydrogenase 95.6
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.55
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 95.45
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 95.4
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.39
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 95.38
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 95.35
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 95.34
COG5564276 Predicted TIM-barrel enzyme, possibly a dioxygenas 95.34
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 95.33
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 95.33
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 95.3
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 95.22
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 95.21
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 95.17
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 95.0
PRK08508279 biotin synthase; Provisional 94.98
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 94.95
cd02812219 PcrB_like PcrB_like proteins. One member of this f 94.93
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 94.92
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 94.88
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 94.87
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) t 94.83
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 94.79
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 94.78
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 94.6
COG4981 717 Enoyl reductase domain of yeast-type FAS1 [Lipid m 94.54
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 94.53
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 94.5
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 94.48
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 94.32
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 94.29
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.29
TIGR02134236 transald_staph transaldolase. This small family of 94.26
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 94.23
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 94.21
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 94.19
PRK02227238 hypothetical protein; Provisional 94.17
PLN02411391 12-oxophytodienoate reductase 94.11
PRK06256336 biotin synthase; Validated 94.04
COG2089 347 SpsE Sialic acid synthase [Cell envelope biogenesi 94.04
PLN02561253 triosephosphate isomerase 94.0
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 93.98
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 93.94
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 93.92
PRK11320 292 prpB 2-methylisocitrate lyase; Provisional 93.9
PRK08662343 nicotinate phosphoribosyltransferase; Reviewed 93.9
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 93.86
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 93.86
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 93.78
KOG2334 477 consensus tRNA-dihydrouridine synthase [Translatio 93.75
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 93.65
TIGR00284499 dihydropteroate synthase-related protein. This pro 93.57
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 93.56
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 93.44
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 93.41
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 93.39
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 93.39
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 93.33
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 93.25
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 93.22
PRK07188352 nicotinate phosphoribosyltransferase; Provisional 93.22
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 93.13
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 93.09
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 93.08
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 93.07
PLN028581378 fructose-bisphosphate aldolase 92.87
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 92.85
PRK04147293 N-acetylneuraminate lyase; Provisional 92.84
TIGR02317 285 prpB methylisocitrate lyase. Members of this famil 92.81
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 92.76
COG2513 289 PrpB PEP phosphonomutase and related enzymes [Carb 92.72
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 92.51
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 92.48
PRK05500 477 bifunctional orotidine 5'-phosphate decarboxylase/ 92.45
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 92.36
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 92.24
PRK15452 443 putative protease; Provisional 92.14
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 92.14
cd08209391 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopent 92.12
PRK09197350 fructose-bisphosphate aldolase; Provisional 92.07
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 91.97
PRK12331 448 oxaloacetate decarboxylase; Provisional 91.9
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 91.85
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 91.78
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 91.75
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 91.67
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 91.65
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 91.64
COG0329 299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 91.64
PRK15492260 triosephosphate isomerase; Provisional 91.64
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 91.61
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 91.58
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 91.53
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 91.44
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 91.29
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 91.28
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 91.17
COG0826 347 Collagenase and related proteases [Posttranslation 91.14
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 91.09
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 91.02
PLN02424332 ketopantoate hydroxymethyltransferase 91.0
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 90.98
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 90.96
PRK11613282 folP dihydropteroate synthase; Provisional 90.94
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 90.93
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 90.88
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 90.88
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 90.86
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 90.76
PRK11572248 copper homeostasis protein CutC; Provisional 90.59
PRK03170292 dihydrodipicolinate synthase; Provisional 90.47
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 90.46
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 90.43
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 90.42
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 90.42
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 90.4
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 90.4
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 90.36
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 90.25
PLN02460338 indole-3-glycerol-phosphate synthase 90.16
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 90.08
cd00423258 Pterin_binding Pterin binding enzymes. This family 90.07
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 89.95
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 89.83
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 89.78
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 89.76
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 89.73
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 89.72
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 89.71
PRK09549407 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate eno 89.67
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=2.5e-52  Score=356.74  Aligned_cols=296  Identities=82%  Similarity=1.251  Sum_probs=286.9

Q ss_pred             EEEeccCCCccccccceeeecCCccccCCCHHHHHHHHHcCCcEEEecccccchhhhcCCCCCCCChHHHHHHHhhcCcc
Q 037779           15 IYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIP   94 (310)
Q Consensus        15 i~e~k~~sp~~~~~~~~~~l~~g~i~~~~~~~~a~~~~~~Ga~~I~~l~~~~~d~r~~~G~~~~~~~~~i~~i~~~~~lP   94 (310)
                      |.|-|.+|||+.++++.|+|+||.|+++.++++|+.++++||++++.|+++|.|+|..+|..+++++..|++|++++.+|
T Consensus         1 ~t~a~~k~pfsvK~GLAQmLkGGvImdVv~~eQA~iAE~aGACaVmalervPadiR~~GgV~RMsDP~mIKei~~aVsiP   80 (296)
T KOG1606|consen    1 ITEAKFKSPFSVKVGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPRMIKEIKNAVSIP   80 (296)
T ss_pred             CccccccCCchhhHHHHHHhcCCeEEEecCHHHHHHHHhcCcceEeeeccCCHhHHhcCCeeecCCHHHHHHHHHhccch
Confidence            45778999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeeccccchHHHHHHHHcCCCeeeecCCCChhHHHHHHHhcCCCCcEEeecCCHHHHHHHHHhCCCEEEEecCCCCCch
Q 037779           95 VMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNI  174 (310)
Q Consensus        95 v~~kd~i~~~~~~~~~~~aGad~v~~~~~~~~~~~~~~~~~~~~~l~v~~~v~t~~ea~~a~~~Gad~I~v~g~~~~~~~  174 (310)
                      |+.|.+++||.++|++++.|+|+|..++.+++.+....+.+|.+.+++++++++.-|+.+-++.||.+|.+.|+.+|+++
T Consensus        81 VMAk~RiGHFVEAQIlE~l~vDYiDESEvlt~AD~~hhI~KhnFkvPFvCG~rdlGEALRRI~EGAAMIRtkGeagTG~v  160 (296)
T KOG1606|consen   81 VMAKVRIGHFVEAQILEALGVDYIDESEVLTPADWDHHIEKHNFKVPFVCGCRDLGEALRRIREGAAMIRTKGEAGTGDV  160 (296)
T ss_pred             hhhhhhhhhhhHHHHHHHhccCccchhhhcccccccchhhhhcCcCceeeccccHHHHHHHHhhchhhheeccccCCCcH
Confidence            99999999999999999999999998899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhcceecccccCchhHHhhhccCCCcHHHHHHHHhcCCCCEEEEccCCCCCHHHHHHHHHcCCCEEEEccc
Q 037779          175 VEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSG  254 (310)
Q Consensus       175 ~~~~~~~~~~~~~~~~l~~~~~d~~~~~~~~~~~~~~l~~~i~~~~~iPVv~ia~GGI~t~~di~~~~~~GadgV~VGsa  254 (310)
                      .+++++.+++..+++.+..+++|.++.+++.+..|++++++.++..++||+-+|+||+.||.|+.-++++|||||.|||.
T Consensus       161 ~EaVkhvr~i~geir~~~~m~~dev~t~Ak~i~aP~dLv~~t~q~GrlPVV~FAaGGvaTPADAALmMQLGCdGVFVGSg  240 (296)
T KOG1606|consen  161 SEAVKHVRSINGEIRVLKNMDDDEVFTFAKEIAAPYDLVKQTKQLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSG  240 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHhcCcHHHHHHHHHcCCCceEEecccCcCChhHHHHHHHcCCCeEEeccc
Confidence            99999999999999999999999998888888899999999999999999999999999999999999999999999999


Q ss_pred             cccCCCHHHHHHHHHHHHHcCCChhhHHhhhhccCCceeccccccchhhhhhccCC
Q 037779          255 VFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVERYANRSD  310 (310)
Q Consensus       255 i~~~~dp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  310 (310)
                      |+++.||.+.++++.+++.+|.+|.++.|+++.+|+.|.|+++++.++++|+|+|.
T Consensus       241 iFks~dP~k~a~aiVqAvthy~dp~~L~evS~~Lg~aM~g~~i~~~~~~~f~ngs~  296 (296)
T KOG1606|consen  241 IFKSGDPVKRARAIVQAVTHYDDPAKLAEVSSGLGEAMVGISIQSIKEARFANGSR  296 (296)
T ss_pred             cccCCCHHHHHHHHHHHHHccCCHHHHHHHhccHHHHhhcccccchhhhhccccCC
Confidence            99999999999999999999999999999999999999999999999999999973



>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) [] Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PLN02363 phosphoribosylanthranilate isomerase Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK12656 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12653 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK12655 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PLN02429 triosephosphate isomerase Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PRK12376 putative translaldolase; Provisional Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG5564 Predicted TIM-barrel enzyme, possibly a dioxygenase [General function prediction only] Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism] Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR02134 transald_staph transaldolase Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02561 triosephosphate isomerase Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK08662 nicotinate phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PRK07188 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>cd08209 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK09549 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
2zbt_A297 Crystal Structure Of Pyridoxine Biosynthesis Protei 1e-103
2nv1_A305 Structure Of The Synthase Subunit Pdx1 (Yaad) Of Pl 7e-92
2nv2_A294 Structure Of The Plp Synthase Complex Pdx12 (YAADE) 9e-92
1znn_A325 Structure Of The Synthase Subunit Of Plp Synthase L 2e-89
2iss_A313 Structure Of The Plp Synthase Holoenzyme From Therm 2e-88
3fem_A297 Structure Of The Synthase Subunit Pdx1.1 (Snz1) Of 2e-86
2yzr_A330 Crystal Structure Of Pyridoxine Biosynthesis Protei 1e-83
4adt_A297 Crystal Structure Of Plasmodial Plp Synthase Length 1e-83
4ads_A282 Crystal Structure Of Plasmodial Plp Synthase Comple 9e-83
3o05_A291 Crystal Structure Of Yeast Pyridoxal 5-Phosphate Sy 2e-82
4fiq_A335 Crystal Structure Of Pyridoxal Biosynthesis Lyase P 1e-78
>pdb|2ZBT|A Chain A, Crystal Structure Of Pyridoxine Biosynthesis Protein From Thermus Thermophilus Hb8 Length = 297 Back     alignment and structure

Iteration: 1

Score = 369 bits (948), Expect = e-103, Method: Compositional matrix adjust. Identities = 184/291 (63%), Positives = 223/291 (76%), Gaps = 1/291 (0%) Query: 20 KKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMS 79 +K F +K G A+M +GGVIMDV TPEQA IAEEAGA AVMALERVPADIRAQGGVARMS Sbjct: 6 EKGTFQIKTGFAEMFKGGVIMDVTTPEQAVIAEEAGAVAVMALERVPADIRAQGGVARMS 65 Query: 80 DPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFR 139 DP++IK+I ++V+IPVMAK RIGHFVEA ILEAIGVD++DESEVLTPADEE+HI+K F+ Sbjct: 66 DPKIIKEIMAAVSIPVMAKVRIGHFVEAMILEAIGVDFIDESEVLTPADEEHHIDKWKFK 125 Query: 140 VPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEV 199 VPFVCG RNLGE+LRRI EGAAMIRTKGEAGTGN+VEAVRH R++ +IR ++++ +DE+ Sbjct: 126 VPFVCGARNLGEALRRIAEGAAMIRTKGEAGTGNVVEAVRHARTMWKEIRYVQSLREDEL 185 Query: 200 FTFAKNIAAPYDLVMQTKQLGRLPVVHFXXXXXXXXXXXXMMMQLGCDXXXXXXXXXXXX 259 +AK I AP++LV GRLPVV+F +MM LG D Sbjct: 186 MAYAKEIGAPFELVKWVHDHGRLPVVNFAAGGIATPADAALMMHLGMDGVFVGSGIFKSG 245 Query: 260 DPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVK-VERYANRS 309 DP +RARAIV+AV +Y+DP+VLAEVS LGE MVGI+L+ +K ER A R Sbjct: 246 DPRKRARAIVRAVAHYNDPEVLAEVSEDLGEPMVGINLDQLKEEERLAKRG 296
>pdb|2NV1|A Chain A, Structure Of The Synthase Subunit Pdx1 (Yaad) Of Plp Synthase From Bacillus Subtilis Length = 305 Back     alignment and structure
>pdb|2NV2|A Chain A, Structure Of The Plp Synthase Complex Pdx12 (YAADE) FROM BACILLUS Subtilis Length = 294 Back     alignment and structure
>pdb|1ZNN|A Chain A, Structure Of The Synthase Subunit Of Plp Synthase Length = 325 Back     alignment and structure
>pdb|2ISS|A Chain A, Structure Of The Plp Synthase Holoenzyme From Thermotoga Maritima Length = 313 Back     alignment and structure
>pdb|3FEM|A Chain A, Structure Of The Synthase Subunit Pdx1.1 (Snz1) Of Plp Synthase From Saccharomyces Cerevisiae Length = 297 Back     alignment and structure
>pdb|2YZR|A Chain A, Crystal Structure Of Pyridoxine Biosynthesis Protein From Methanocaldococcus Jannaschii Length = 330 Back     alignment and structure
>pdb|4ADT|A Chain A, Crystal Structure Of Plasmodial Plp Synthase Length = 297 Back     alignment and structure
>pdb|4ADS|A Chain A, Crystal Structure Of Plasmodial Plp Synthase Complex Length = 282 Back     alignment and structure
>pdb|3O05|A Chain A, Crystal Structure Of Yeast Pyridoxal 5-Phosphate Synthase Snz1 Complxed With Substrate Plp Length = 291 Back     alignment and structure
>pdb|4FIQ|A Chain A, Crystal Structure Of Pyridoxal Biosynthesis Lyase Pdxs From Pyrococcus Horikoshii Length = 335 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 1e-138
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 1e-137
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 1e-135
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 1e-134
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 1e-127
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 1e-19
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 6e-17
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 9e-09
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 5e-08
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 6e-08
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 6e-08
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 3e-07
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 1e-04
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 3e-04
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 5e-04
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 6e-04
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 7e-04
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 8e-04
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Length = 297 Back     alignment and structure
 Score =  391 bits (1006), Expect = e-138
 Identities = 168/289 (58%), Positives = 220/289 (76%)

Query: 15  IYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGG 74
           + +        +K G  +ML+GGVIMDV   EQA+IAE+AGA  VM LE +P+++R   G
Sbjct: 1   MRDYADNDSILLKHGWCEMLKGGVIMDVKNVEQAKIAEKAGAIGVMILENIPSELRNTDG 60

Query: 75  VARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHIN 134
           VAR  DP  I++I+  ++I V+AK RIGHFVEAQILE + VD +DESEVLT ADE NHIN
Sbjct: 61  VARSVDPLKIEEIRKCISINVLAKVRIGHFVEAQILEELKVDMLDESEVLTMADEYNHIN 120

Query: 135 KHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNM 194
           KH F+ PFVCGC NLGE+LRRI EGA+MIRTKGEAGTGNI+EA++H+R+V  +I+ L ++
Sbjct: 121 KHKFKTPFVCGCTNLGEALRRISEGASMIRTKGEAGTGNIIEAIKHIRTVNNEIKYLCSL 180

Query: 195 DDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSG 254
           D+ EV+ FAK + AP DL++ T++L RLPVV+FAAGG+ATPADAAM MQLG DGVFVGSG
Sbjct: 181 DESEVYNFAKKLRAPIDLILLTRKLKRLPVVNFAAGGIATPADAAMCMQLGMDGVFVGSG 240

Query: 255 VFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDLNDVKVE 303
           +F+S +P + A +IV AV+N+++P +L  VS GLG+AM G      K +
Sbjct: 241 IFESENPQKMASSIVMAVSNFNNPKILLNVSLGLGKAMHGNTKVSNKWK 289


>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Length = 297 Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Length = 291 Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Length = 305 Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Length = 330 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Length = 234 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} Length = 232 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Length = 264 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Length = 265 Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Length = 268 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Length = 223 Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Length = 225 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Length = 226 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Length = 262 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} PDB: 3exs_A* 3ext_A Length = 221 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Length = 219 Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Length = 227 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 100.0
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 100.0
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 100.0
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 100.0
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 100.0
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 100.0
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 100.0
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 100.0
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 99.98
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 99.98
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 99.96
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 99.87
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 99.86
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 99.77
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 99.77
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.76
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 99.76
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.75
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.74
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.72
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 99.72
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.68
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 99.67
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.67
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 99.64
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 99.63
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.62
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 99.58
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 99.58
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 99.57
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.57
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 99.56
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 99.56
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 99.56
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 99.56
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 99.55
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 99.55
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 99.55
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 99.54
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.52
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 99.52
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.51
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 99.5
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 99.5
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 99.48
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 99.48
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 99.48
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 99.48
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.47
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 99.46
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 99.46
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 99.46
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 99.45
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 99.45
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 99.44
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 99.44
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 99.43
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 99.43
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 99.43
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 99.42
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 99.42
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 99.41
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.4
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 99.38
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 99.37
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 99.37
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 99.34
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 99.33
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 99.32
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 99.29
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 99.27
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 99.24
1ujp_A271 Tryptophan synthase alpha chain; riken structural 99.23
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 99.16
1viz_A240 PCRB protein homolog; structural genomics, unknown 99.15
3tha_A252 Tryptophan synthase alpha chain; structural genomi 99.15
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.14
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 99.08
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 99.06
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 99.06
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 99.03
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 99.02
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.0
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 98.93
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.93
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 98.93
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 98.9
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.88
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 98.87
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 98.86
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 98.85
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 98.83
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 98.82
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.82
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 98.81
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 98.81
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 98.81
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 98.79
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 98.79
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 98.77
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.77
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 98.76
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 98.75
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 98.75
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 98.74
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 98.74
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 98.74
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 98.73
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 98.73
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 98.73
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 98.72
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.72
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 98.71
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 98.71
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 98.67
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 98.62
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.62
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 98.6
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 98.6
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 98.56
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 98.56
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.49
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 98.47
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 98.46
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 98.44
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 98.4
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 98.37
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.36
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 98.35
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 98.33
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 98.33
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 98.29
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 98.29
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 98.25
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 98.25
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 98.23
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.23
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 98.21
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 98.19
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 98.15
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 98.14
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.11
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 98.06
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 98.05
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 98.04
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 98.03
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 98.03
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 98.02
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 98.02
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 98.0
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.99
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 97.99
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 97.98
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 97.96
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 97.93
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 97.93
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 97.92
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 97.91
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 97.9
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 97.9
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 97.89
3kts_A192 Glycerol uptake operon antiterminator regulatory; 97.84
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 97.83
3oa3_A288 Aldolase; structural genomics, seattle structural 97.82
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 97.8
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 97.8
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 97.76
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 97.73
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 97.71
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 97.7
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 97.69
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 97.65
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.64
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 97.61
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 97.58
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 97.57
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.57
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 97.55
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 97.48
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 97.47
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 97.47
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 97.45
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 97.45
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 97.44
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 97.41
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 97.4
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 97.32
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 97.27
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 97.25
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 97.22
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.21
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 97.21
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 97.19
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 97.16
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 97.16
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 97.15
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 97.14
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 97.12
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 97.08
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 97.08
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 96.98
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 96.97
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 96.93
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 96.91
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 96.91
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 96.89
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 96.89
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 96.89
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 96.87
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 96.87
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 96.86
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 96.85
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 96.83
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.8
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 96.65
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 96.65
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 96.65
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 96.63
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 96.62
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.58
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 96.56
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 96.55
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 96.55
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 96.5
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.49
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 96.47
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 96.45
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 96.42
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 96.36
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 96.34
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 96.21
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 96.18
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 96.17
3qw3_A255 Orotidine-5-phosphate decarboxylase/orotate phosph 96.17
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 96.17
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 96.15
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 96.11
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 96.08
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.06
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 96.04
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 96.03
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 95.98
1yya_A250 Triosephosphate isomerase; riken structural genomi 95.97
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 95.9
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 95.9
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 95.89
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 95.89
3r8r_A212 Transaldolase; pentose phosphate pathway, schiff b 95.85
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 95.79
3s1x_A223 Probable transaldolase; alpha-beta barrel, conform 95.72
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 95.68
3qw4_B 453 UMP synthase; N-terminal orotidine monophosphate d 95.67
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 95.65
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 95.49
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.45
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 95.43
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 95.41
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 95.36
2ffc_A353 Orotidine 5-monophosphate decarboxylase; PV-PF10_0 95.34
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 95.33
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 95.33
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 95.3
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 95.28
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 95.25
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 95.24
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 95.11
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 95.1
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 95.09
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 95.05
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.03
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 95.03
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.95
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.91
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 94.91
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 94.9
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 94.88
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 94.87
2i1o_A398 Nicotinate phosphoribosyltransferase; ZIN ION, zin 94.84
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 94.82
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 94.78
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 94.74
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 94.67
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 94.66
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 94.65
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 94.63
1izc_A339 Macrophomate synthase intermolecular diels-aldera; 94.63
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 94.58
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 94.49
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher 94.48
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.48
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 94.45
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 94.39
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 94.27
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 94.26
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 94.22
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.21
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 94.17
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 94.14
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 94.1
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 94.08
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 94.0
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 93.98
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 93.94
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 93.86
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 93.83
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 93.68
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 93.63
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 93.63
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 93.61
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 93.49
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 93.48
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 93.45
1b9b_A255 TIM, protein (triosephosphate isomerase); thermoph 93.39
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 93.36
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 93.32
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 93.26
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 93.2
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 93.18
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 93.16
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 93.13
1viz_A240 PCRB protein homolog; structural genomics, unknown 93.07
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 93.05
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 93.04
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 93.03
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 93.0
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 92.96
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 92.84
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 92.83
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 92.76
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 92.76
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 92.63
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 92.56
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 92.56
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 92.53
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 92.49
1twd_A 256 Copper homeostasis protein CUTC; TIM-like protein, 92.48
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 92.4
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 92.23
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 92.23
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 92.08
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 92.07
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 92.02
2v5b_A244 Triosephosphate isomerase; TIM, unfolding, monotct 91.99
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 91.86
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 91.85
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 91.77
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 91.55
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 91.54
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 91.35
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 91.32
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 91.2
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 91.12
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 91.09
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 91.07
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 91.02
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 90.92
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 90.78
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 90.57
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 90.55
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 90.55
3qst_A255 Triosephosphate isomerase, putative; TIM barrel; 1 90.4
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 90.35
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 90.35
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 90.32
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 90.25
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 90.25
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 90.1
3gdm_A267 Orotidine 5'-phosphate decarboxylase; orotidine 5' 90.08
3g3d_A312 UMP synthase, uridine 5'-monophosphate synthase; C 90.03
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 90.03
3th6_A249 Triosephosphate isomerase; alpha/beta barrel, embr 89.9
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 89.86
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 89.82
2yxg_A 289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 89.82
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 89.73
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 89.67
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 89.65
3eww_A260 Ompdecase, orotidine-5'-phosphate decarboxylase; T 89.63
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 89.59
2ehh_A 294 DHDPS, dihydrodipicolinate synthase; structural ge 89.58
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 89.43
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 89.41
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 89.31
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 89.3
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 89.28
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 89.25
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 89.24
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 89.17
2i14_A395 Nicotinate-nucleotide pyrophosphorylase; ligand bi 89.13
2fiq_A420 Putative tagatose 6-phosphate kinase 1; structural 89.11
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 89.09
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 89.09
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 89.04
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 89.03
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 88.98
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 88.89
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 88.84
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 88.83
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 88.76
3elf_A349 Fructose-bisphosphate aldolase; zinc enzyme, dihyd 88.62
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 88.57
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 88.56
2vc6_A 292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 88.55
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 88.53
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 88.48
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 88.47
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 88.47
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 88.38
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 88.34
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 88.33
3daq_A 292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 88.31
3m5v_A 301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 88.29
3kts_A192 Glycerol uptake operon antiterminator regulatory; 88.18
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 88.14
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 88.04
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 87.86
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 87.75
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 87.67
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 87.43
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 87.36
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 87.35
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 87.23
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 87.22
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 87.11
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 87.0
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 86.75
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 86.74
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 86.65
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 86.65
3eb2_A 300 Putative dihydrodipicolinate synthetase; lysine bi 86.62
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 86.61
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 86.54
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 85.92
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 85.89
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 85.85
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 85.83
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 85.64
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 85.61
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 85.55
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 85.49
3a5f_A 291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 85.45
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 85.39
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 85.23
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 85.16
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 84.97
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 84.97
3h5d_A 311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 84.88
1dos_A358 Aldolase class II; lyase, classii fructose 1,6-bis 84.86
2hmc_A 344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 84.85
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 84.81
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 84.61
3txv_A 450 Probable tagatose 6-phosphate kinase; structural g 84.59
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 84.22
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 84.16
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 84.12
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 84.07
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 83.99
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 83.95
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 83.95
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 83.91
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 83.91
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 83.91
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 83.86
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 83.81
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 83.76
2f7f_A 494 Nicotinate phosphoribosyltransferase, putative; st 83.68
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 83.65
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 83.64
3ble_A337 Citramalate synthase from leptospira interrogans; 83.44
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 83.4
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 83.37
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 83.05
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 82.68
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 82.5
2oz8_A389 MLL7089 protein; structural genomics, unknown func 82.46
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 82.44
3luf_A259 Two-component system response regulator/ggdef doma 82.44
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 82.41
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 82.23
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 81.68
3s5o_A 307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 81.36
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 81.03
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 81.01
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 80.74
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 80.56
2hjp_A 290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 80.49
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 80.37
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 80.24
3eul_A152 Possible nitrate/nitrite response transcriptional 80.01
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
Probab=100.00  E-value=2.5e-48  Score=348.39  Aligned_cols=277  Identities=61%  Similarity=1.009  Sum_probs=244.7

Q ss_pred             eecCCccccCCCHHHHHHHHHcCCcEEEecccccchhhhcCCCCCCCChHHHHHHHhhcCcceEeeccccchHHHHHHHH
Q 037779           33 MLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEA  112 (310)
Q Consensus        33 ~l~~g~i~~~~~~~~a~~~~~~Ga~~I~~l~~~~~d~r~~~G~~~~~~~~~i~~i~~~~~lPv~~kd~i~~~~~~~~~~~  112 (310)
                      +|++|.|+++.++++|+.++++||.+++.|.++|+|+|.++|..++++++.|++|++.+++||+.+++++|+.++|++++
T Consensus         9 ~~~~~vimdv~~~eqa~iae~aGa~av~~l~~~p~d~r~~gGv~Rm~dp~~I~~I~~aVsIPVm~k~righ~~EAqilea   88 (291)
T 3o07_A            9 MLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFVEAQIIEA   88 (291)
T ss_dssp             -CTTCEEEEESSHHHHHHHHHHTCSEEEECSSCHHHHHTTTCCCCCCCHHHHHHHHTTCSSCEEEEEETTCHHHHHHHHH
T ss_pred             cccCCeeeecCCHHHHHHHHHhCchhhhhccCCCchhhhcCCccccCCHHHHHHHHHhCCCCeEEEEecCcHHHHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCeeeecCCCChhHHHHHHHhcCCCCcEEeecCCHHHHHHHHHhCCCEEEEecCCCCCchHHHHHHHHHhhcceeccc
Q 037779          113 IGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLR  192 (310)
Q Consensus       113 aGad~v~~~~~~~~~~~~~~~~~~~~~l~v~~~v~t~~ea~~a~~~Gad~I~v~g~~~~~~~~~~~~~~~~~~~~~~~l~  192 (310)
                      +|+|+|..++.++|.+....+.++.++++++++++|+.|+.++++.||++|++.|+.+||+..+++++.|.++.+++.+.
T Consensus        89 ~GaD~IDesevltpad~~~~I~k~~f~vpfv~~~~~l~EAlrri~eGA~mIrTtge~gtg~v~~av~h~r~~~~~i~~l~  168 (291)
T 3o07_A           89 LEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRITEEIKACQ  168 (291)
T ss_dssp             TTCSEEEEETTSCCSCSSCCCCGGGCSSCEEEEESSHHHHHHHHHHTCSEEEECCCTTSCCTHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCEEecccCCCHHHHHHHhhhhcCCCcEEeeCCCHHHHHHHHHCCCCEEEecCcCCCccHHHHHHHHHHHHHHHHHHH
Confidence            99999988888899888888877668899999999999999999999999999999999999999999999999999888


Q ss_pred             cc-CchhHHhhhccCCCcHHHHHHHHhcCCCCEEEEccCCCCCHHHHHHHHHcCCCEEEEccccccCCCHHHHHHHHHHH
Q 037779          193 NM-DDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQA  271 (310)
Q Consensus       193 ~~-~~d~~~~~~~~~~~~~~l~~~i~~~~~iPVv~ia~GGI~t~~di~~~~~~GadgV~VGsai~~~~dp~~~~~~~~~~  271 (310)
                      .+ +.+.+..+++...++|++++.+++..++||++|++|||+|++++.+++++|||||+|||++++++||..++++|.++
T Consensus       169 g~~t~~el~~~a~~~~ad~elI~~Ike~~~IPVV~IAnGGI~TpedA~~~le~GaDGVmVGrAI~~s~DP~~~Akafv~A  248 (291)
T 3o07_A          169 QLKSEDDIAKVAEEMRVPVSLLKDVLEKGKLPVVNFAAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEA  248 (291)
T ss_dssp             TCCCHHHHHHHHHHHTSCHHHHHHHHHHTSCSSCEEBCSSCCSHHHHHHHHHTTCSCEEECGGGGGSSCHHHHHHHHHHH
T ss_pred             cCCCHHHhhhcccccCCCHHHHHHHHHccCCCEEEecCCCCCCHHHHHHHHHhCCCEEEEchHHhCCCCHHHHHHHHHHH
Confidence            88 77666555566678999999999988899987899999999999999999999999999999999999999999999


Q ss_pred             HHcCCChhhHHhhhhccCCceeccccccc---h-hhhhhccC
Q 037779          272 VTNYSDPDVLAEVSCGLGEAMVGIDLNDV---K-VERYANRS  309 (310)
Q Consensus       272 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~-~~~~~~~~  309 (310)
                      +++|.+|.+++|+++.+|++|.||+..+.   + -||++.|.
T Consensus       249 v~~~~~~~~~~~~s~~l~~~m~g~~~~~~~~~~~~~~~~~rg  290 (291)
T 3o07_A          249 TTHFDNPSKLLEVSSDLGELMGGVSIESISHASNGVRLSEIG  290 (291)
T ss_dssp             HHTTTCHHHHHHHHSSCCCC----------------------
T ss_pred             HHhccCHHHHHHHHhcccccccCcchhhhccCchHHHHhhcC
Confidence            99999999999999999999999999988   3 45777663



>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis} Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1izc_A Macrophomate synthase intermolecular diels-aldera; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3gdm_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, K93R mutant, lyase, phosphoprotein; 1.60A {Saccharomyces cerevisiae} SCOP: c.1.2.3 PDB: 3gdl_A* 3gdk_A* 3gdt_A* 3gdr_A* 1dqw_A 1dqx_A* Back     alignment and structure
>3g3d_A UMP synthase, uridine 5'-monophosphate synthase; C-terminal domain, orotidine 5'-monophosphate decarboxylase, human, 5-fluoro-6-azido-UMP; HET: 5FU; 1.70A {Homo sapiens} PDB: 3bvj_A* 3mw7_A* 4hib_A* 4hkp_A* 2p1f_A 2eaw_A 3bgg_A* 3bgj_A* Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3eww_A Ompdecase, orotidine-5'-phosphate decarboxylase; TIM barrel, unusual catalysis, disease mutati glycosyltransferase, lyase, multifunctional enzyme; HET: U1P; 1.10A {Homo sapiens} PDB: 2qcl_A* 2qcm_A* 3ewu_A* 2qcf_A* 3ex6_A* 3ex4_A* 2qcd_A* 2qcc_A 2qcg_A* 2qch_A* 2qcn_A* 2qce_A* 3ewz_A* 3ex1_A* 3ex2_A* 3ex3_A* 3ex0_A* 3ex5_A* 3l0k_A* 3l0n_A* ... Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3elf_A Fructose-bisphosphate aldolase; zinc enzyme, dihydroxyacetone, glyceraldehyd phosphate, aldol condensation, glycolysis, lyase; HET: 2FP; 1.31A {Mycobacterium tuberculosis} PDB: 3ekz_A* 3ekl_A* 4a22_A* 4a21_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>1dos_A Aldolase class II; lyase, classii fructose 1,6-bisphosphate aldolase, glycolysis; 1.67A {Escherichia coli} SCOP: c.1.10.2 PDB: 1b57_A* 1gyn_A 1zen_A Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>2f7f_A Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI; 2.00A {Enterococcus faecalis} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 310
d1znna1254 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase Pd 1e-142
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 2e-30
d1hg3a_224 c.1.1.1 (A:) Triosephosphate isomerase {Archaeon P 3e-22
d1wv2a_243 c.1.31.1 (A:) Thiazole biosynthesis protein ThiG { 3e-21
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 6e-16
d1xm3a_251 c.1.31.1 (A:) Thiazole biosynthesis protein ThiG { 5e-12
d1w0ma_226 c.1.1.1 (A:) Triosephosphate isomerase {Thermoprot 2e-07
d2tpsa_226 c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus 2e-06
d1xi3a_206 c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon 2e-05
d1q6oa_213 c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarbo 8e-05
d1gtea2312 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenas 3e-04
d1ep3a_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 0.002
d1rd5a_261 c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Ze 0.002
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: PdxS-like
domain: Pyridoxal biosynthesis lyase PdxS
species: Bacillus stearothermophilus [TaxId: 1422]
 Score =  398 bits (1024), Expect = e-142
 Identities = 172/254 (67%), Positives = 213/254 (83%)

Query: 35  RGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIP 94
           +GGVIMDVV  EQA+IAE AGA AVMALERVPADIRA GGVARM+DP +I+++ ++V+IP
Sbjct: 1   KGGVIMDVVNAEQAKIAEAAGAVAVMALERVPADIRAAGGVARMADPTVIEEVMNAVSIP 60

Query: 95  VMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLR 154
           VMAK RIGH+VEA++LEA+GVDY+DESEVLTPADEE HI+K  F VPFVCGCR+LGE+ R
Sbjct: 61  VMAKVRIGHYVEARVLEALGVDYIDESEVLTPADEEFHIDKRQFTVPFVCGCRDLGEAAR 120

Query: 155 RIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVM 214
           RI EGA+M+RTKGE GTGNIVEAVRH+R V   IR + NM +DE+   AK + AP +++ 
Sbjct: 121 RIAEGASMLRTKGEPGTGNIVEAVRHMRKVNAQIRKVVNMSEDELVAEAKQLGAPVEVLR 180

Query: 215 QTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTN 274
           + K+LGRLPVV+FAAGGV TPADAA+MM LG DGVFVGSG+FKS +P + ARAIV+A T+
Sbjct: 181 EIKRLGRLPVVNFAAGGVTTPADAALMMHLGADGVFVGSGIFKSENPEKYARAIVEATTH 240

Query: 275 YSDPDVLAEVSCGL 288
           Y D +++A +S GL
Sbjct: 241 YEDYELIAHLSKGL 254


>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 224 Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Length = 243 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Length = 251 Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Length = 226 Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Length = 206 Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Length = 312 Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Length = 261 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 100.0
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 100.0
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 100.0
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 100.0
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 100.0
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 99.75
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.74
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 99.72
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.7
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 99.58
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 99.52
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 99.52
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 99.52
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 99.51
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 99.48
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 99.46
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 99.45
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 99.3
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 99.28
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 99.26
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 99.24
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 99.22
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 99.2
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 99.2
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 99.15
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 99.15
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 99.13
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 99.12
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 99.12
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 99.07
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 99.06
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 99.06
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 99.05
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 99.02
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 99.02
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 98.96
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 98.93
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 98.92
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 98.91
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 98.88
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 98.65
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 98.61
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 98.2
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 98.15
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 98.11
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 98.07
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 97.86
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 97.86
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 97.85
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 97.85
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 97.83
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 97.78
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 97.76
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 97.73
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 97.72
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 97.69
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 97.64
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 97.63
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 97.6
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 97.57
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 97.56
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.51
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 97.5
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 97.43
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 97.41
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 97.35
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 97.34
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 97.31
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 97.28
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 97.24
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 97.23
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 97.22
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 97.19
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 97.19
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 97.11
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 97.09
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 97.02
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 97.0
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 96.97
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 96.93
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 96.81
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 96.8
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 96.74
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 96.62
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 96.45
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 96.43
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 96.31
d1l6wa_220 Decameric fructose-6-phosphate aldolase/transaldol 96.3
d1eepa_ 388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 96.26
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.25
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.25
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 96.24
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 96.21
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 96.21
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 96.19
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 96.15
d1ofda2809 Alpha subunit of glutamate synthase, central and F 96.12
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 96.07
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 95.79
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 95.78
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 95.58
d1vqta1198 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.57
d1pvna1 362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 95.52
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 95.45
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.44
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 95.4
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 95.35
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 95.33
d1wx0a1211 Decameric fructose-6-phosphate aldolase/transaldol 95.13
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.1
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 94.95
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 94.77
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 94.53
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 94.3
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 93.99
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 93.69
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 93.46
d2cu0a1 368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 93.33
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 93.33
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 92.99
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 92.83
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 92.52
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 92.45
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 92.33
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 92.25
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 92.2
d1dqwa_267 Orotidine 5'-monophosphate decarboxylase (OMP deca 92.16
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 92.13
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 92.11
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 91.86
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 91.81
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 91.71
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 91.62
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 91.47
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 91.38
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 91.29
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 91.22
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 91.15
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 91.15
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 91.12
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 91.11
d1k66a_149 Response regulator for cyanobacterial phytochrome 90.9
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 90.76
d1k68a_140 Response regulator for cyanobacterial phytochrome 90.75
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 90.63
d1i3ca_144 Response regulator for cyanobacterial phytochrome 90.61
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 90.27
d1mb3a_123 Cell division response regulator DivK {Caulobacter 90.14
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 90.07
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 90.04
d1s8na_190 Probable two-component system transcriptional regu 89.89
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 89.77
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 89.74
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 89.71
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 89.58
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 89.41
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 89.16
d1qkka_140 Transcriptional regulatory protein DctD, receiver 88.99
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 88.86
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 88.65
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 88.34
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 88.32
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 87.47
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 87.28
d1muma_ 289 2-methylisocitrate lyase {Escherichia coli [TaxId: 87.1
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 86.88
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 86.85
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 86.63
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 86.58
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 86.21
d1geha1307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 85.89
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 85.84
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 85.48
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 85.4
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 85.37
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 84.88
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 84.83
d1trea_255 Triosephosphate isomerase {Escherichia coli [TaxId 84.67
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 84.62
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 84.45
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 84.4
d1vlia2295 Spore coat polysaccharide biosynthesis protein Sps 83.5
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 83.39
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 83.32
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 83.29
d2fdsa1324 Protozoan orotidine monophosphate decarboxylase {P 83.19
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 82.83
d1vkfa_172 Glycerol uptake operon antiterminator-related prot 82.57
d2btma_251 Triosephosphate isomerase {Bacillus stearothermoph 82.34
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 81.84
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 81.7
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 81.65
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 81.59
d2a6na1 292 Dihydrodipicolinate synthase {Escherichia coli [Ta 81.58
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 81.34
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 80.82
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 80.61
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 80.48
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: PdxS-like
domain: Pyridoxal biosynthesis lyase PdxS
species: Bacillus stearothermophilus [TaxId: 1422]
Probab=100.00  E-value=5.8e-36  Score=258.57  Aligned_cols=254  Identities=68%  Similarity=1.077  Sum_probs=227.4

Q ss_pred             cCCccccCCCHHHHHHHHHcCCcEEEecccccchhhhcCCCCCCCChHHHHHHHhhcCcceEeeccccchHHHHHHHHcC
Q 037779           35 RGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIG  114 (310)
Q Consensus        35 ~~g~i~~~~~~~~a~~~~~~Ga~~I~~l~~~~~d~r~~~G~~~~~~~~~i~~i~~~~~lPv~~kd~i~~~~~~~~~~~aG  114 (310)
                      +||.|+++.+++.|+.++++|+..++.|+++|.|+|.-+|..+++++..++++.+.+.+|++.|.+++|+.++|+|.+.|
T Consensus         1 kgGvimDv~~~eqA~iAe~aGAvaVmaLervpadiR~~GGvaRm~dp~~i~ei~~~vsipvmak~righ~~eaqiLe~~~   80 (254)
T d1znna1           1 KGGVIMDVVNAEQAKIAEAAGAVAVMALERVPADIRAAGGVARMADPTVIEEVMNAVSIPVMAKVRIGHYVEARVLEALG   80 (254)
T ss_dssp             CCEEEEEESSHHHHHHHHHHTCSEEEECC---------CCCCCCCCHHHHHHHHHHCSSCEEEEEETTCHHHHHHHHHHT
T ss_pred             CCceEEeccCHHHHHHhhccCceeEeeeccCCHHHHhcCCcccCCCHHHHHHHHHhcccccccccCCCchHHHHhHHhhC
Confidence            57999999999999999999999999999999999998999999999999999999999999999999999999999999


Q ss_pred             CCeeeecCCCChhHHHHHHHhcCCCCcEEeecCCHHHHHHHHHhCCCEEEEecCCCCCchHHHHHHHHHhhcceeccccc
Q 037779          115 VDYVDESEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGEAGTGNIVEAVRHVRSVMGDIRVLRNM  194 (310)
Q Consensus       115 ad~v~~~~~~~~~~~~~~~~~~~~~l~v~~~v~t~~ea~~a~~~Gad~I~v~g~~~~~~~~~~~~~~~~~~~~~~~l~~~  194 (310)
                      .|++..++.++|.+....+.++.+.++++++++|+-|+.+-+..||..+...|+..++++.++++++|.+....+.+..+
T Consensus        81 vd~ideseVLTpad~~~hi~k~~fkvpfVcg~r~Lgealrri~EgAamIrtkGeagtgnvveav~h~R~i~~~i~~~~~m  160 (254)
T d1znna1          81 VDYIDESEVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRHMRKVNAQIRKVVNM  160 (254)
T ss_dssp             CSEEEEETTSCCSCSSCCCCGGGCSSCEEEEESSHHHHHHHHHTTCSEEEECCCTTSCCCHHHHHHHHHHHHHHHHHHHS
T ss_pred             CCcccHhHhcccccHHHhhcccceeeeeeCCCCccchhHHHHHHHHHHHHhCCccCCCcHHHHHHHHHHHHHHHHHHHcC
Confidence            99999888999888887787777899999999999999999999999999999999999999999999999998877777


Q ss_pred             CchhHHhhhccCCCcHHHHHHHHhcCCCCEEEEccCCCCCHHHHHHHHHcCCCEEEEccccccCCCHHHHHHHHHHHHHc
Q 037779          195 DDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTN  274 (310)
Q Consensus       195 ~~d~~~~~~~~~~~~~~l~~~i~~~~~iPVv~ia~GGI~t~~di~~~~~~GadgV~VGsai~~~~dp~~~~~~~~~~~~~  274 (310)
                      +.+.+...+++++.++++..++.+..++||+.|++|||.||.|+..++++|||||+|||+|++++||.++++++..++.+
T Consensus       161 ~~~el~~~ak~lg~p~~l~~~v~~~g~l~v~~~~~~Gi~tpadaa~~MelG~dgV~v~s~I~~s~dP~~~a~A~~~Avt~  240 (254)
T d1znna1         161 SEDELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGGVTTPADAALMMHLGADGVFVGSGIFKSENPEKYARAIVEATTH  240 (254)
T ss_dssp             CGGGHHHHHHHHTCCHHHHHHHHHHTSCSSEEEEESSCCSHHHHHHHHHTTCSEEEECGGGGGSSCHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHhhCCchHHHHHHHHhCCCCceEEecCCCCChhhHHHHHHcCCCEEEEcchhhcCCCHHHHHHHHHHHHHc
Confidence            66666555677888999999999877777777999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhHHhhhhcc
Q 037779          275 YSDPDVLAEVSCGL  288 (310)
Q Consensus       275 ~~~~~~~~~~~~~~  288 (310)
                      |.+|++++|++..+
T Consensus       241 ~~dp~~~~~~s~~l  254 (254)
T d1znna1         241 YEDYELIAHLSKGL  254 (254)
T ss_dssp             TTCHHHHHHHTTTC
T ss_pred             cCCHHHHHHhcCCC
Confidence            99999999998753



>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vkfa_ c.1.29.1 (A:) Glycerol uptake operon antiterminator-related protein TM1436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure