Citrus Sinensis ID: 037819

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKFI
cEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccccccccccccccccEEccEEcccccEEEEEEEcccccccccccccccccccccccccccccccccEEccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccc
cEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEcHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEcHHHHHccHHHHHHHHHHHHccccccccccHHcccEEEccEEcccccEEEEEEEEEEcccHHcccHHHcccHHHcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHcccccccccEEcccccEEEEccccc
KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKlsaapaaadndyvsseapinLSEMAMTLIRNIIFRvgfgkrfedegtaTVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEdhldpkrpkvaeqEDLIDVLLVSNRRSWYyikklifpdeniaatDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKdkgfvdeddlTRLEYLKAVVKETmrfqpaaqflprettercvidgyhipaktTVFVNVLAIgrdgqvwdkpdefiperfvgsnidmggqnfefipfgagrricaglpiAMPIVELALANLLYkfdwtmprgmeiddldydvrpgftqhkknpllLAATKFI
kkfvthmlsanrteqfrqvQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDhldpkrpkvaeqedLIDVLLVSNRRSWYYIKklifpdeniaatDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKdkgfvdeddltrLEYLKAVVKETmrfqpaaqflpreTTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGftqhkknplllaatkfi
KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKFI
*******************QTDEIFRMIEKISKL**********YV**EAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLD****KVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQH****LL*******
KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSA***********SEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLI******************DVLLVSNRRSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKFI
KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISK*********NDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKFI
KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRP***EQEDLIDVLLVSNRRSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAAT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query377 2.2.26 [Sep-21-2011]
O65782499 Cytochrome P450 83B1 OS=A yes no 0.954 0.721 0.423 1e-79
O81970499 Cytochrome P450 71A9 OS=G no no 0.954 0.721 0.412 4e-77
P24465502 Cytochrome P450 71A1 OS=P N/A no 0.957 0.719 0.403 8e-72
Q9LIP6500 Cytochrome P450 71B34 OS= no no 0.949 0.716 0.385 6e-70
P48421502 Cytochrome P450 83A1 OS=A no no 0.949 0.713 0.374 2e-66
Q9LIP5500 Cytochrome P450 71B35 OS= no no 0.944 0.712 0.371 2e-65
Q9LTM0501 Cytochrome P450 71B23 OS= no no 0.949 0.714 0.373 2e-64
Q9LTL0500 Cytochrome P450 71B26 OS= no no 0.944 0.712 0.376 2e-64
P58050496 Cytochrome P450 71B13 OS= no no 0.938 0.713 0.376 5e-64
Q9SAE4490 Cytochrome P450 71B29 OS= no no 0.893 0.687 0.374 5e-63
>sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 Back     alignment and function desciption
 Score =  296 bits (759), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 165/390 (42%), Positives = 234/390 (60%), Gaps = 30/390 (7%)

Query: 1   KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMT 60
           K  + ++ S NR   FR V+ +E  RM++KI K      AAD         ++LSE+ ++
Sbjct: 127 KMCMVNLFSPNRVASFRPVREEECQRMMDKIYK------AADQS-----GTVDLSELLLS 175

Query: 61  LIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWN 120
               ++ R  FGKR+ + GT  + R   +  ETQA++G +FF D  P+ G +LD+LTG +
Sbjct: 176 FTNCVVCRQAFGKRYNEYGT-EMKRFIDILYETQALLGTLFFSDLFPYFG-FLDNLTGLS 233

Query: 121 RRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENI 180
            RL+  F + D   Q+L+++ LDP RPK  E E  ID+L+   +   + IK   F  EN+
Sbjct: 234 ARLKKAFKELDTYLQELLDETLDPNRPK-QETESFIDLLMQIYKDQPFSIK---FTHENV 289

Query: 181 AA---------TDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEY 231
            A         TDT    + WAMT L+K  EAMKK Q EVR V+ DKG+V E+D+  L Y
Sbjct: 290 KAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRSVIGDKGYVSEEDIPNLPY 349

Query: 232 LKAVVKETMRFQPAAQ-FLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVW-DKPDE 289
           LKAV+KE++R +P     L RET     I GY IPAKT + VN  A+ RD   W D P+E
Sbjct: 350 LKAVIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNE 409

Query: 290 FIPERFVGSN--IDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRG 347
           FIPERF+  +  +D  GQ+FE +PFG+GRR+C  + + + +VE+  ANLLYKFDW++P+G
Sbjct: 410 FIPERFMNEHKGVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKG 469

Query: 348 MEIDDLDYDVRPGFTQHKKNPLLLAATKFI 377
           ++ +D+  DV  G   HKK  L+LA TK I
Sbjct: 470 IKPEDIKMDVMTGLAMHKKEHLVLAPTKHI 499
Involved in the metabolism of aromatic oximes. Catalyzes the oxime metabolizing step in indole glucosinolate biosynthesis by converting indole-3-acetaldoxime into indole-3-S-alkyl-thiohydroximate. Probably required for glucosinolate activation in response to pathogens. Functions in auxin homeostasis because indole-3-acetaldoxime also serves as a precursor for auxin biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 Back     alignment and function description
>sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 Back     alignment and function description
>sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 Back     alignment and function description
>sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
255538870 497 cytochrome P450, putative [Ricinus commu 0.952 0.722 0.510 1e-102
302142620 912 unnamed protein product [Vitis vinifera] 0.949 0.392 0.509 1e-99
225458053 498 PREDICTED: cytochrome P450 83B1 [Vitis v 0.949 0.718 0.509 3e-99
225458059 496 PREDICTED: cytochrome P450 83B1-like [Vi 0.946 0.719 0.5 3e-97
225458055 495 PREDICTED: cytochrome P450 83B1 [Vitis v 0.944 0.719 0.488 1e-96
225458051 498 PREDICTED: cytochrome P450 83B1 [Vitis v 0.949 0.718 0.503 2e-94
225458057 494 PREDICTED: cytochrome P450 71A1 [Vitis v 0.941 0.718 0.5 4e-94
224065988 504 cytochrome P450 [Populus trichocarpa] gi 0.952 0.712 0.485 5e-94
225458049 496 PREDICTED: cytochrome P450 83B1 [Vitis v 0.949 0.721 0.482 6e-94
224097756 504 cytochrome P450 [Populus trichocarpa] gi 0.952 0.712 0.477 3e-93
>gi|255538870|ref|XP_002510500.1| cytochrome P450, putative [Ricinus communis] gi|223551201|gb|EEF52687.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 257/382 (67%), Gaps = 23/382 (6%)

Query: 4   VTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIR 63
           V H+ ++N+ + FR ++  E+  M+EKISKL+AA             P++LSE  M+L  
Sbjct: 131 VVHLFNSNKVQSFRPIREFEVSHMLEKISKLAAA-----------TKPVDLSEAMMSLTS 179

Query: 64  NIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRL 123
            II RV FGKR+E+EG    +R  ++  ETQA+    F  D  PF+G ++D LTG NRRL
Sbjct: 180 TIICRVAFGKRYEEEGIER-TRFQALLEETQALFTSFFVSDYFPFLG-FVDRLTGMNRRL 237

Query: 124 RNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLL-VSNRRSWY------YIKKLIFP 176
             NF + D  Y Q+I++HLDP RPK  EQED++DVLL +   RS+       +IK ++  
Sbjct: 238 EKNFKEFDIFYNQIIQEHLDPSRPK-PEQEDILDVLLQIWKDRSFKAHLTPDHIKAILM- 295

Query: 177 DENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVV 236
           +  +  TDT    + WAMT LMKN+ AMKK Q+EVR++   KGFVDEDD  +L YLKAV+
Sbjct: 296 NVFVGGTDTSAAAVVWAMTFLMKNSIAMKKAQEEVRHIFGKKGFVDEDDTQQLVYLKAVI 355

Query: 237 KETMRFQPAAQFL-PRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERF 295
           KETMR QP    L PRE+T+ C + GY IPAKT V+VN LAIGRD +VW+ P+EF PERF
Sbjct: 356 KETMRLQPTVPLLIPRESTQDCNLSGYEIPAKTVVYVNALAIGRDPEVWENPEEFCPERF 415

Query: 296 VGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDY 355
           +G ++D+ GQ+FE +PFGAGRRIC G+ I +  VEL+LANLLYKFDW MP GM+ +DLD 
Sbjct: 416 IGKSVDLKGQDFELVPFGAGRRICPGIFIGLVTVELSLANLLYKFDWEMPAGMKKEDLDM 475

Query: 356 DVRPGFTQHKKNPLLLAATKFI 377
           DV PG   HKKN L L A ++I
Sbjct: 476 DVNPGIAVHKKNALCLEAREYI 497

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302142620|emb|CBI19823.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458053|ref|XP_002280472.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] gi|147832399|emb|CAN64422.1| hypothetical protein VITISV_032274 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458059|ref|XP_002278372.1| PREDICTED: cytochrome P450 83B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458055|ref|XP_002278300.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458051|ref|XP_002280459.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458057|ref|XP_002278387.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224065988|ref|XP_002301993.1| cytochrome P450 [Populus trichocarpa] gi|222843719|gb|EEE81266.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458049|ref|XP_002280438.1| PREDICTED: cytochrome P450 83B1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224097756|ref|XP_002334586.1| cytochrome P450 [Populus trichocarpa] gi|222873361|gb|EEF10492.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
TAIR|locus:2125264499 CYP83B1 ""cytochrome P450, fam 0.962 0.727 0.421 3.1e-74
TAIR|locus:2079251500 CYP71B34 ""cytochrome P450, fa 0.957 0.722 0.390 5.8e-66
TAIR|locus:2093561500 CYP71B26 ""cytochrome P450, fa 0.944 0.712 0.378 2e-63
TAIR|locus:2119500502 CYP83A1 ""cytochrome P450, fam 0.957 0.719 0.376 4.2e-63
TAIR|locus:2079306500 CYP71B35 ""cytochrome P450, fa 0.946 0.714 0.369 7.9e-62
TAIR|locus:2093531501 CYP71B23 ""cytochrome P450, fa 0.957 0.720 0.373 1.3e-61
TAIR|locus:2179290496 CYP71B13 ""cytochrome P450, fa 0.938 0.713 0.378 8.1e-60
TAIR|locus:2031820504 CYP71B7 ""cytochrome P450, fam 0.952 0.712 0.363 2.7e-59
TAIR|locus:2093516502 CYP71B20 ""cytochrome P450, fa 0.960 0.721 0.363 4.5e-59
TAIR|locus:2031805490 CYP71B29 ""cytochrome P450, fa 0.901 0.693 0.374 4.5e-59
TAIR|locus:2125264 CYP83B1 ""cytochrome P450, family 83, subfamily B, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 749 (268.7 bits), Expect = 3.1e-74, P = 3.1e-74
 Identities = 163/387 (42%), Positives = 233/387 (60%)

Query:     1 KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMT 60
             K  + ++ S NR   FR V+ +E  RM++KI K      AAD         ++LSE+ ++
Sbjct:   127 KMCMVNLFSPNRVASFRPVREEECQRMMDKIYK------AADQS-----GTVDLSELLLS 175

Query:    61 LIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWN 120
                 ++ R  FGKR+ + GT  + R   +  ETQA++G +FF D  P+ G +LD+LTG +
Sbjct:   176 FTNCVVCRQAFGKRYNEYGTE-MKRFIDILYETQALLGTLFFSDLFPYFG-FLDNLTGLS 233

Query:   121 RRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIK------KLI 174
              RL+  F + D   Q+L+++ LDP RPK  E E  ID+L+   +   + IK      K +
Sbjct:   234 ARLKKAFKELDTYLQELLDETLDPNRPK-QETESFIDLLMQIYKDQPFSIKFTHENVKAM 292

Query:   175 FPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKA 234
               D  +  TDT    + WAMT L+K  EAMKK Q EVR V+ DKG+V E+D+  L YLKA
Sbjct:   293 ILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRSVIGDKGYVSEEDIPNLPYLKA 352

Query:   235 VVKETMRFQPAAQFL-PRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVW-DKPDEFIP 292
             V+KE++R +P    L  RET     I GY IPAKT + VN  A+ RD   W D P+EFIP
Sbjct:   353 VIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIP 412

Query:   293 ERFVGSN--IDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEI 350
             ERF+  +  +D  GQ+FE +PFG+GRR+C  + + + +VE+  ANLLYKFDW++P+G++ 
Sbjct:   413 ERFMNEHKGVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKP 472

Query:   351 DDLDYDVRPGFTQHKKNPLLLAATKFI 377
             +D+  DV  G   HKK  L+LA TK I
Sbjct:   473 EDIKMDVMTGLAMHKKEHLVLAPTKHI 499
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA;IMP
GO:0009759 "indole glucosinolate biosynthetic process" evidence=IDA
GO:0000162 "tryptophan biosynthetic process" evidence=IMP
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0048830 "adventitious root development" evidence=TAS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0052544 "defense response by callose deposition in cell wall" evidence=IMP
GO:0009682 "induced systemic resistance" evidence=IEP
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0006520 "cellular amino acid metabolic process" evidence=RCA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0006733 "oxidoreduction coenzyme metabolic process" evidence=RCA
GO:0006766 "vitamin metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009072 "aromatic amino acid family metabolic process" evidence=RCA
GO:0009106 "lipoate metabolic process" evidence=RCA
GO:0009108 "coenzyme biosynthetic process" evidence=RCA
GO:0009117 "nucleotide metabolic process" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019748 "secondary metabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0044272 "sulfur compound biosynthetic process" evidence=RCA
GO:0009641 "shade avoidance" evidence=IMP
GO:0010114 "response to red light" evidence=IMP
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093561 CYP71B26 ""cytochrome P450, family 71, subfamily B, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119500 CYP83A1 ""cytochrome P450, family 83, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179290 CYP71B13 ""cytochrome P450, family 71, subfamily B, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031820 CYP71B7 ""cytochrome P450, family 71 subfamily B, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031805 CYP71B29 ""cytochrome P450, family 71, subfamily B, polypeptide 29"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 9e-97
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-77
pfam00067461 pfam00067, p450, Cytochrome P450 6e-68
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-65
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-65
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-64
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-63
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-43
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-40
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-39
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 6e-31
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 9e-31
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-30
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-27
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 7e-22
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 3e-21
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 8e-21
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 5e-15
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-13
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 7e-12
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 6e-11
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-10
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 5e-10
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 8e-09
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 2e-08
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 9e-08
PLN02648480 PLN02648, PLN02648, allene oxide synthase 3e-06
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information 
 Score =  296 bits (759), Expect = 9e-97
 Identities = 165/390 (42%), Positives = 234/390 (60%), Gaps = 30/390 (7%)

Query: 1   KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMT 60
           K  + ++ S NR   FR V+ +E  RM++KI K      AAD         ++LSE+ ++
Sbjct: 127 KMCMVNLFSPNRVASFRPVREEECQRMMDKIYK------AADQ-----SGTVDLSELLLS 175

Query: 61  LIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWN 120
               ++ R  FGKR+ + GT  + R   +  ETQA++G +FF D  P+ G +LD+LTG +
Sbjct: 176 FTNCVVCRQAFGKRYNEYGT-EMKRFIDILYETQALLGTLFFSDLFPYFG-FLDNLTGLS 233

Query: 121 RRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENI 180
            RL+  F + D   Q+L+++ LDP RPK  E E  ID+L+   +   + IK   F  EN+
Sbjct: 234 ARLKKAFKELDTYLQELLDETLDPNRPK-QETESFIDLLMQIYKDQPFSIK---FTHENV 289

Query: 181 AA---------TDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEY 231
            A         TDT    + WAMT L+K  EAMKK Q EVR V+ DKG+V E+D+  L Y
Sbjct: 290 KAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVIGDKGYVSEEDIPNLPY 349

Query: 232 LKAVVKETMRFQPAAQ-FLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVW-DKPDE 289
           LKAV+KE++R +P     L RET     I GY IPAKT + VN  A+ RD   W D P+E
Sbjct: 350 LKAVIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNE 409

Query: 290 FIPERFVGSN--IDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRG 347
           FIPERF+  +  +D  GQ+FE +PFG+GRR+C  + + + +VE+  ANLLYKFDW++P+G
Sbjct: 410 FIPERFMKEHKGVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKG 469

Query: 348 MEIDDLDYDVRPGFTQHKKNPLLLAATKFI 377
           ++ +D+  DV  G   HKK  L+LA TK I
Sbjct: 470 IKPEDIKMDVMTGLAMHKKEHLVLAPTKHI 499

Length = 499
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 377
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-67  Score=484.07  Aligned_cols=354  Identities=40%  Similarity=0.677  Sum_probs=312.2

Q ss_pred             cceeccCChHHHHHhHhhHHHHHHHHHHHHHHHhcCCcccCCcCCCCCCceehHHHHHHHHHHHHHHHHhccccccccch
Q 037819            2 KFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTA   81 (377)
Q Consensus         2 ~~~~~~fs~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~vdl~~~~~~~~~~vi~~~~fG~~~~~~~~~   81 (377)
                      -++..+++.+.++++.....++++.+++.+.+ ..           .+++||+...+..++.++|++++||.+|+..+.+
T Consensus       127 ~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~-----------~~~~vdl~~~l~~~~~nvI~~~~fG~rf~~~~~~  194 (489)
T KOG0156|consen  127 FALTELRSFGRGKSFMEIREEEVDELVKKLSK-SK-----------KGEPVDLSELLDLLVGNVICRMLFGRRFEEEDEE  194 (489)
T ss_pred             HHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-cC-----------CCceeeHHHHHHHHHHHHHHHHHhCCccccCCch
Confidence            35667899999999988889999999999997 22           3389999999999999999999999999986544


Q ss_pred             hhHHHHHHHHHHHHhhcccccccccc-cchhhhhhhhhHHHHHHhhHhhHHHHHHHHHHhhcCCCCCCccchhhHHHHHH
Q 037819           82 TVSRLHSVFAETQAMVGRVFFRDCLP-FVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLL  160 (377)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~P-~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~d~l~~ll  160 (377)
                      ...++...+.+.....+.+.+.+++| +++ ++++..+..++......++..+++..|++|++..+. ++ +.|++|.|+
T Consensus       195 ~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~-~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~~-~~-~~D~vD~lL  271 (489)
T KOG0156|consen  195 EFLELKELVEESLELLGSFNLSDYFPFLLR-WLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIGD-EE-GRDFVDALL  271 (489)
T ss_pred             HHHHHHHHHHHHHHHhCCccHHHHhhHHHH-hcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhcc-CC-CCcHHHHHH
Confidence            66679999999999999999999999 566 766555667777777778999999999999876522 22 489999999


Q ss_pred             hccC------cchHHhhhhccccchhcccccHHHHHHHHHHHHHhChHHHHHHHHHHHHHhhcCCCCChhhhcccHHHHH
Q 037819          161 VSNR------RSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKA  234 (377)
Q Consensus       161 ~~~~------l~~~~l~~~~~~~~~~ag~~tt~~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~~~~lp~l~a  234 (377)
                      +..+      ++++++.+ .+.++++||+|||++|+.|++.+|++||++|+|+|+||+++++.++.++.+|+.++|||+|
T Consensus       272 ~~~~~~~~~~~t~~~i~~-~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r~v~e~D~~~lpYL~A  350 (489)
T KOG0156|consen  272 KLMKEEKAEGLTDDHLKA-LILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGRLVSESDLPKLPYLKA  350 (489)
T ss_pred             HhhcccccCCCCHHHHHH-HHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCChhhhccCHHHHH
Confidence            7744      78999999 9999999999999999999999999999999999999999999887799999999999999


Q ss_pred             HHHHhhcCCCCCC-CCcccccccceecceeeCCCCEEEecchhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccC
Q 037819          235 VVKETMRFQPAAQ-FLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFG  313 (377)
Q Consensus       235 ~i~E~lRl~p~~~-~~~R~~~~d~~i~g~~Ip~gt~v~~~~~~~~~d~~~~~dp~~f~p~R~l~~~~~~~~~~~~~~~Fg  313 (377)
                      +|+|++|++|++| .++|.+++|+.++||.|||||.|.++.|++|+||++|+||++|+||||++++ +.+.....++|||
T Consensus       351 vi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~~-d~~~~~~~~iPFG  429 (489)
T KOG0156|consen  351 VIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDSN-DGKGLDFKLIPFG  429 (489)
T ss_pred             HHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCCc-cccCCceEecCCC
Confidence            9999999999999 8899999999999999999999999999999999999999999999999984 3333677999999


Q ss_pred             CCCCCCCCHhhHHHHHHHHHHHHHHcceeEcCCCCCCCCCCCcccCCccccccCCeeeEEeecC
Q 037819          314 AGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKFI  377 (377)
Q Consensus       314 ~G~r~C~G~~lA~~~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~  377 (377)
                      .|+|.|||..+|.+++.++++.||++|+|+.+.+    .+|+... +++...+.++.+...+|.
T Consensus       430 ~GRR~CpG~~La~~~l~l~la~llq~F~w~~~~~----~~d~~e~-~~~~~~~~pl~~~~~~r~  488 (489)
T KOG0156|consen  430 SGRRICPGEGLARAELFLFLANLLQRFDWKLPGG----KVDMEEA-GLTLKKKKPLKAVPVPRL  488 (489)
T ss_pred             CCcCCCCcHHHHHHHHHHHHHHHHheeeeecCCC----CCCCccc-ccceecCCcceeeeecCC
Confidence            9999999999999999999999999999999765    3566555 466666778887777663

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 7e-23
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-21
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-21
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 3e-21
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-20
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 3e-20
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 4e-20
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 8e-20
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 1e-19
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 1e-19
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 1e-19
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-19
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-19
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-19
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-19
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 1e-18
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-17
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-17
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 2e-17
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-17
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 5e-17
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 5e-17
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 6e-17
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 1e-16
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-16
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 9e-16
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 1e-15
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 8e-15
3pm0_A507 Structural Characterization Of The Complex Between 9e-15
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-14
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-14
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-14
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 3e-14
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-14
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-14
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 7e-14
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 6e-13
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 8e-13
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 2e-12
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 9e-12
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-11
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-11
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 6e-11
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 6e-11
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 6e-11
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 6e-11
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 6e-11
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 6e-11
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 6e-11
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 6e-11
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-11
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 7e-11
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 7e-11
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 8e-11
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-10
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 1e-10
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-10
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-10
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-10
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-10
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 2e-10
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-10
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-10
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-10
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-10
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-10
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 2e-10
1fah_A471 Structure Of Cytochrome P450 Length = 471 2e-10
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-10
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 2e-10
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 3e-10
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-10
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 3e-10
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 3e-10
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 3e-10
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-10
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-10
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 6e-10
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 7e-10
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 9e-10
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 1e-09
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-09
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 1e-09
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 2e-09
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-09
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 3e-09
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 3e-08
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 3e-08
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 6e-08
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 1e-07
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 5e-07
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 5e-07
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 5e-07
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 2e-06
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-06
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 2e-06
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-06
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 2e-06
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 2e-06
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 4e-06
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 7e-06
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 1e-05
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 1e-05
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 2e-05
2rcm_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 2e-05
2rch_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 2e-05
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 4e-05
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 5e-05
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 5e-05
1pkf_A419 Crystal Structure Of Epothilone D-Bound Cytochrome 7e-05
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 8e-05
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 8e-05
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 8e-05
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 9e-05
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 9e-05
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 1e-04
1q5d_A419 Epothilone B-Bound Cytochrome P450epok Length = 419 1e-04
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 3e-04
1odo_A408 1.85 A Structure Of Cyp154a1 From Streptomyces Coel 6e-04
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (260), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 137/306 (44%), Gaps = 20/306 (6%)
Query: 60  TLIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGW 119
           ++  NII  + FGKRF  +    +  L ++F +T +++  VF +    F G +L    G 
Sbjct: 154 SITANIICSIVFGKRFHYQDQEFLKML-NLFYQTFSLISSVFGQLFELFSG-FLKHFPGA 211
Query: 120 NRRLRNNFSDCDKVYQQLIEDH---LDPKRPKVAEQEDLIDVLLV------SNRRSWYYI 170
           +R++  N  + +      +E H   LDP  P+     DLID  L+      SN  S +  
Sbjct: 212 HRQVYKNLQEINAYIGHSVEKHRETLDPSAPR-----DLIDTYLLHMEKEKSNAHSEFSH 266
Query: 171 KKLIFPDENI--AATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTR 228
           + L     ++  A T+T   TL +    ++K     ++V +E+  V+      +  D  +
Sbjct: 267 QNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAK 326
Query: 229 LEYLKAVVKETMRFQPAAQF-LPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKP 287
           + Y +AV+ E  RF       +P   T+     GY IP  T VF+ +     D   ++KP
Sbjct: 327 MPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKP 386
Query: 288 DEFIPERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRG 347
           D F P+ F+ +N  +      FIPF  G+RIC G  IA   + L    +L  F    P  
Sbjct: 387 DAFNPDHFLDANGALKKTE-AFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVA 445
Query: 348 MEIDDL 353
            E  DL
Sbjct: 446 PEDIDL 451
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|2RCM|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 74a) At 1.73 A Resolution Length = 495 Back     alignment and structure
>pdb|2RCH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 13(S)-Hod At 1.85 A Resolution Length = 495 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|1ODO|A Chain A, 1.85 A Structure Of Cyp154a1 From Streptomyces Coelicolor A3(2) Length = 408 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-102
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-92
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-87
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-80
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-65
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-63
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-62
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-55
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-54
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-51
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-50
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-49
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-49
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 7e-47
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-47
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 7e-45
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-44
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-43
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 3e-43
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-43
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-42
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-42
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-41
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-41
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 8e-41
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-35
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-33
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 5e-33
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-32
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 3e-11
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 9e-11
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 2e-10
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 2e-10
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 5e-10
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 9e-10
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 1e-09
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 2e-09
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 2e-09
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 9e-09
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 1e-08
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 3e-08
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 3e-08
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 3e-08
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 3e-08
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 4e-08
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 4e-08
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 6e-08
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 6e-08
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 6e-08
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 8e-08
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 8e-08
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 1e-07
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 1e-07
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 1e-07
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-07
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 2e-07
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-07
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 3e-07
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 3e-07
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 3e-07
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 6e-07
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-06
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 2e-06
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 3e-06
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 3e-06
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 4e-06
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 5e-06
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 6e-06
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 9e-06
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 2e-05
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 1e-04
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 2e-04
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 7e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  309 bits (794), Expect = e-102
 Identities = 70/385 (18%), Positives = 121/385 (31%), Gaps = 31/385 (8%)

Query: 1   KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMT 60
                 +++   T+ F  +        +  + +             S     ++S+    
Sbjct: 112 VALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAG-------SGNYSGDISDDLFR 164

Query: 61  LIRNIIFRVGFGKRFEDEGTATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWN 120
                I  V FG+R                     M         LP     L     W 
Sbjct: 165 FAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTW- 223

Query: 121 RRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENI 180
           +     +           ++     R K +   D   +L          +       E+I
Sbjct: 224 KDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILY-------RLLGDSKMSFEDI 276

Query: 181 ---------AATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEY 231
                       DT  +TL+W +  + +N +    ++ EV              L  +  
Sbjct: 277 KANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPL 336

Query: 232 LKAVVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFI 291
           LKA +KET+R  P +  L R      V+  Y IPAKT V V + A+GR+   +  P+ F 
Sbjct: 337 LKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFD 396

Query: 292 PERFVGSNIDMGGQNFEFIPFGAGRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEID 351
           P R++  + +     F  + FG G R C G  IA   + + L N+L  F   +    ++ 
Sbjct: 397 PTRWLSKDKN--ITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDV- 453

Query: 352 DLDYDVRPGFTQHKKNPLLLAATKF 376
                         + P+      F
Sbjct: 454 ----GTTFNLILMPEKPISFTFWPF 474
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-64  Score=475.44  Aligned_cols=350  Identities=20%  Similarity=0.308  Sum_probs=286.9

Q ss_pred             CcceeccCChHHHHHhHhhHHHHHHHHHHHHHHHhcCCcccCCcCCCCCCceehHHHHHHHHHHHHHHHHhccccccccc
Q 037819            1 KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGT   80 (377)
Q Consensus         1 R~~~~~~fs~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~vdl~~~~~~~~~~vi~~~~fG~~~~~~~~   80 (377)
                      |++++++|+.++++.+++.+.++++.+++.|.....           +++++|+.+++..+++|+++.++||.+++....
T Consensus        90 Rr~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~-----------~~~~vd~~~~~~~~~~dvi~~~~fG~~~~~~~~  158 (456)
T 3mdm_A           90 RRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKAD-----------GQTPVSMQDMLTYTAMDILAKAAFGMETSMLLG  158 (456)
T ss_dssp             HHHHGGGGSHHHHHTTHHHHHHHHHHHHHHHHHTCS-----------SSSCEEHHHHHHHHHHHHHHHHHHSCCCCGGGT
T ss_pred             HhhcccccCHHHHHHHHHHHHHHHHHHHHHHHHhcC-----------CCCeeeHHHHHHHHHHHHHHHHHcCCChhhhcc
Confidence            678999999999999999999999999999987543           567999999999999999999999999986543


Q ss_pred             hhhHHHHHHHHHHHHhhcccccccccccchhhhhhhhhHHHHHHhhHhhHHHHHHHHHHhhcCCCCCCccchhhHHHHHH
Q 037819           81 ATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLL  160 (377)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~d~l~~ll  160 (377)
                       ....+...+..+...+...    ..|++. +++......+...+....+.+++.+.++++++..+.+.....|+++.++
T Consensus       159 -~~~~~~~~~~~~~~~~~~~----~~~~~~-~~p~~~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~~~~~~d~l~~ll  232 (456)
T 3mdm_A          159 -AQKPLSQAVKLMLEGITAS----RNTLAK-FLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQIL  232 (456)
T ss_dssp             -CCHHHHHHHHHHHHHHHHH----HHSCGG-GCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCCHHHHHH
T ss_pred             -cccHHHHHHHHHHHHHHHH----HHHHHH-hCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccchhhHHHHHH
Confidence             2334444444444332211    012222 2221111233445566667777777787776543222222579999999


Q ss_pred             hccC--cchHHhhhhccccchhcccccHHHHHHHHHHHHHhChHHHHHHHHHHHHHhhcCCCCChhhhcccHHHHHHHHH
Q 037819          161 VSNR--RSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKE  238 (377)
Q Consensus       161 ~~~~--l~~~~l~~~~~~~~~~ag~~tt~~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~~~~lp~l~a~i~E  238 (377)
                      +...  ++++++.+ ++..+++||+|||+++|+|++++|+.||++|+||++||++++++++.++++++.+||||+|||+|
T Consensus       233 ~~~~~~~~~~~l~~-~~~~l~~AG~dTTa~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~a~i~E  311 (456)
T 3mdm_A          233 KAEEGAQDDEGLLD-NFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKE  311 (456)
T ss_dssp             HHTSSCSSSHHHHH-HHHHHHHHTTHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTTTCSSCCHHHHHHCHHHHHHHHH
T ss_pred             HhcCCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHcCCCCCCCHHHHhcCHHHHHHHHH
Confidence            7643  88899999 99999999999999999999999999999999999999999998888999999999999999999


Q ss_pred             hhcCCCCCCCCcccccccceecceeeCCCCEEEecchhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccCCCCCC
Q 037819          239 TMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAGRRI  318 (377)
Q Consensus       239 ~lRl~p~~~~~~R~~~~d~~i~g~~Ip~gt~v~~~~~~~~~d~~~~~dp~~f~p~R~l~~~~~~~~~~~~~~~Fg~G~r~  318 (377)
                      +||++|+++.+.|.+.+|++++||.|||||.|+++.+++||||++|+||++|+||||++..   ......++|||.|+|.
T Consensus       312 ~lRl~p~~~~~~r~~~~d~~i~g~~Ip~Gt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~---~~~~~~~~pFg~G~r~  388 (456)
T 3mdm_A          312 SLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA---PKPRFTYFPFSLGHRS  388 (456)
T ss_dssp             HHHHCCSSCCEEEEECSCEEETTEEECSSEEEEECHHHHHTCTTTSSSTTSCCGGGGSTTS---CCCSSSCCTTCCGGGS
T ss_pred             HHHhCCCccccccccCCceeECCEEECCCCEEEeehHHhcCCchhcCCccccCccccCCCC---CCCCCcccCCCCCCcC
Confidence            9999999998889999999999999999999999999999999999999999999999864   2234579999999999


Q ss_pred             CCCHhhHHHHHHHHHHHHHHcceeEcCCCCCCCCCCCcccCCccccccCCeeeEEeec
Q 037819          319 CAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKF  376 (377)
Q Consensus       319 C~G~~lA~~~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r  376 (377)
                      |||++||.+|++++++.||++|+|+++++.   .+++  ..+.+..|+.++.+++++|
T Consensus       389 C~G~~lA~~e~~~~la~ll~~f~~~~~~~~---~~~~--~~~~~~~p~~~~~~~~~~r  441 (456)
T 3mdm_A          389 CIGQQFAQMEVKVVMAKLLQRLEFRLVPGQ---RFGL--QEQATLKPLDPVLCTLRPR  441 (456)
T ss_dssp             CTTHHHHHHHHHHHHHHHHHHEEEEECTTC---CCCE--EESSSEEESSCCEEEEEEC
T ss_pred             CCCHHHHHHHHHHHHHHHHHhCeEEeCCCC---ccee--ecceEEecCCCeEEEEEEc
Confidence            999999999999999999999999987653   2223  3345667888999999987
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 377
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 9e-46
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-44
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-42
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 5e-25
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-24
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-21
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 6e-21
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 5e-17
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-16
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 1e-15
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 4e-15
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 1e-14
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-13
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 2e-13
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-13
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-13
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 5e-13
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 1e-12
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-12
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-11
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-11
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  161 bits (406), Expect = 9e-46
 Identities = 72/360 (20%), Positives = 137/360 (38%), Gaps = 14/360 (3%)

Query: 24  IFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGTATV 83
           +  M+  I++              +  P+ L ++      ++I    FG   +       
Sbjct: 115 LKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQD 174

Query: 84  SRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLD 143
             + +     +      FF     F   +L  +              + + + +      
Sbjct: 175 PFVENTKKLLRFDFLDPFFLSITVF--PFLIPILEVLNICVFPREVTNFLRKSVKRMKES 232

Query: 144 PKRPKVAEQEDLIDVLLVSNRRSWYYIKKLIFPDENIA--------ATDTIKVTLEWAMT 195
                   + D + +++ S         K +   E +A          +T    L + M 
Sbjct: 233 RLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMY 292

Query: 196 NLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKAVVKETMRFQPAAQFLPRETTE 255
            L  + +  +K+Q+E+  V+ +K     D + ++EYL  VV ET+R  P A  L R   +
Sbjct: 293 ELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKK 352

Query: 256 RCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGAG 315
              I+G  IP    V +   A+ RD + W +P++F+PERF   N D     + + PFG+G
Sbjct: 353 DVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD-NIDPYIYTPFGSG 411

Query: 316 RRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATK 375
            R C G+  A+  ++LAL  +L  F +   +  +I      +  G     + P++L    
Sbjct: 412 PRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQI---PLKLSLGGLLQPEKPVVLKVES 468
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1.7e-62  Score=459.28  Aligned_cols=345  Identities=20%  Similarity=0.287  Sum_probs=282.7

Q ss_pred             CcceeccCChHHHHHhHhhHHHHHHHHHHHHHHHhcCCcccCCcCCCCCCceehHHHHHHHHHHHHHHHHhccccccccc
Q 037819            1 KKFVTHMLSANRTEQFRQVQTDEIFRMIEKISKLSAAPAAADNDYVSSEAPINLSEMAMTLIRNIIFRVGFGKRFEDEGT   80 (377)
Q Consensus         1 R~~~~~~fs~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~vdl~~~~~~~~~~vi~~~~fG~~~~~~~~   80 (377)
                      |+++.++|+.++++++.+.+.++++++++.|.               .++++|+.+.++.+++++++.++||.+++..  
T Consensus        94 ~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~l~---------------~~~~vdl~~~~~~~~~~~~~~~~fG~~~~~~--  156 (445)
T d2ciba1          94 EMLHNAALRGEQMKGHAATIEDQVRRMIADWG---------------EAGEIDLLDFFAELTIYTSSACLIGKKFRDQ--  156 (445)
T ss_dssp             -------CCHHHHHHHHHHHHHHHHHHHTTCC---------------SEEEEEHHHHHHHHHHHHHHHHHTCHHHHTT--
T ss_pred             HHHhccccCccccccchHHHHHHHHHhhhhcc---------------cCCCcchHHhhhhhcceeeeeccccccccch--
Confidence            56788999999999999999999999998875               5678999999999999999999999988654  


Q ss_pred             hhhHHHHHHHHHHHHhhcccccccccccchhhhhhhhhHHHHHHhhHhhHHHHHHHHHHhhcCCCCCCccchhhHHHHHH
Q 037819           81 ATVSRLHSVFAETQAMVGRVFFRDCLPFVGCWLDSLTGWNRRLRNNFSDCDKVYQQLIEDHLDPKRPKVAEQEDLIDVLL  160 (377)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~d~l~~ll  160 (377)
                       ....+.+....+......+      +.+.++++  ....++..+..+.+.+++.+.+++++++...+.. ..|+++.|+
T Consensus       157 -~~~~~~~~~~~~~~~~~~~------~~~~~~l~--~~~~~~~~~~~~~l~~~~~~~i~~~~~~~~~~~~-~~dll~~ll  226 (445)
T d2ciba1         157 -LDGRFAKLYHELERGTDPL------AYVDPYLP--IESFRRRDEARNGLVALVADIMNGRIANPPTDKS-DRDMLDVLI  226 (445)
T ss_dssp             -CCHHHHHHHHHHHTTCCGG------GGTCTTCS--CHHHHHHHHHHHHHHHHHHHHHHHHHHCC------CCCHHHHHH
T ss_pred             -hhhHHHHHHHHhhhhhhhh------ccccchhh--hHHHHHHHHHHHHHHHHHHHHHhhhccccccccc-ccchhhhhh
Confidence             2344555555554433221      11111221  1245677888899999999999988877655443 679999999


Q ss_pred             hccC------cchHHhhhhccccchhcccccHHHHHHHHHHHHHhChHHHHHHHHHHHHHhhcCCCCChhhhcccHHHHH
Q 037819          161 VSNR------RSWYYIKKLIFPDENIAATDTIKVTLEWAMTNLMKNAEAMKKVQKEVRYVVKDKGFVDEDDLTRLEYLKA  234 (377)
Q Consensus       161 ~~~~------l~~~~l~~~~~~~~~~ag~~tt~~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~~~~lp~l~a  234 (377)
                      +...      ++++++.+ +++.+++||++||+.+++|++++|+.||++|++||+||++++++++.++++++.++|||+|
T Consensus       227 ~~~~~~~~~~ls~~ei~~-~~~~ll~ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~~~~~~~~~~~~~~l~~lp~L~a  305 (445)
T d2ciba1         227 AVKAETGTPRFSADEITG-MFISMMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYGDGRSVSFHALRQIPQLEN  305 (445)
T ss_dssp             HCBCTTSSBSCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHGGGCCCHHHHTTSCCHHHHH
T ss_pred             ccccccccccCCcchhhh-hhhhhhhhccccchhhcccccccccccccccccccccccccccccccchhhhcccchhhcc
Confidence            6532      88999999 9999999999999999999999999999999999999999998888899999999999999


Q ss_pred             HHHHhhcCCCCCCCCcccccccceecceeeCCCCEEEecchhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccCC
Q 037819          235 VVKETMRFQPAAQFLPRETTERCVIDGYHIPAKTTVFVNVLAIGRDGQVWDKPDEFIPERFVGSNIDMGGQNFEFIPFGA  314 (377)
Q Consensus       235 ~i~E~lRl~p~~~~~~R~~~~d~~i~g~~Ip~gt~v~~~~~~~~~d~~~~~dp~~f~p~R~l~~~~~~~~~~~~~~~Fg~  314 (377)
                      ||+|++|++|+++...|.+++|+.++|+.|||||.|+++.+++|+||++|+||++|+||||++.+.+....+..|+|||+
T Consensus       306 ~i~E~lRl~p~~~~~~~~~~~~~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~PeRf~~~~~~~~~~~~~~~pFG~  385 (445)
T d2ciba1         306 VLKETLRLHPPLIILMRVAKGEFEVQGHRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPRQEDLLNRWTWIPFGA  385 (445)
T ss_dssp             HHHHHHHHSCSCCCEEEEECSCEEETTEEECTTCEEEECHHHHTTCTTTSSSTTSCCGGGGSTTTCHHHHCTTTCCTTCC
T ss_pred             ccccccccccccceeccccccccccceeeccccccccccccccccCcccCCChhhCCcccccCccccccCCCCcccCCCC
Confidence            99999999999998889999999999999999999999999999999999999999999999765433335568999999


Q ss_pred             CCCCCCCHhhHHHHHHHHHHHHHHcceeEcCCCCCCCCCCCcccCCccccccCCeeeEEeec
Q 037819          315 GRRICAGLPIAMPIVELALANLLYKFDWTMPRGMEIDDLDYDVRPGFTQHKKNPLLLAATKF  376 (377)
Q Consensus       315 G~r~C~G~~lA~~~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r  376 (377)
                      |+|.|||++||..|++++|+.||++|+|+++.+.   ..+.......+..|+.+++|++++|
T Consensus       386 G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~---~~~~~~~~~~~~~~~~~~~v~~~~R  444 (445)
T d2ciba1         386 GRHRCVGAAFAIMQIKAIFSVLLREYEFEMAQPP---ESYRNDHSKMVVQLAQPAAVRYRRR  444 (445)
T ss_dssp             GGGCCTTHHHHHHHHHHHHHHHHHHEEEEESSCG---GGCCEECSSSSCEECSCCEEEEEEC
T ss_pred             CCccChhHHHHHHHHHHHHHHHHHhCEEEECCCC---CccccccceEEEccCCCEEEEEEeC
Confidence            9999999999999999999999999999987653   1222233455667888999999998
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure