Citrus Sinensis ID: 037933


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
ESFFGNYALCGPPKLRVPPCKPDNSKRTKKIALIVLKYVLPLIVSTVLIVITIIMYIRCRNRSTKKSDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK
ccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccEEcccccEEEEEEcccccEEEEc
cccccccHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEHHHHHHHcccccHHcccccccccEEEEEEcccccEEEEc
esffgnyalcgppklrvppckpdnskrtKKIALIVLKYVLPLIVSTVLIVITIIMYIrcrnrstkksdhedflplatwrrTSYLDIQRATDefnecnllgtgsfgsvykgtisdgtdvaik
esffgnyalcgppklrvppckpdnskRTKKIALIVLKYVLPLIVSTVLIVITIIMYIrcrnrstkksdhedflplatwrRTSYLDIQRATDEfnecnllgtgsfgsvykgtisdgtdvaik
ESFFGNYALCGPPKLRVPPCKPDNSKRTKKIALIVLKYvlplivstvlivitiiMYIRCRNRSTKKSDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK
***FGNYALCGP****************KKIALIVLKYVLPLIVSTVLIVITIIMYIRCRNRSTK*SDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTI*********
ESFFGNYALCGPPK*********************LKYVLPLIVSTVLIVITIIMYIR********************RRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK
ESFFGNYALCGPPKLRVPPCKPDNSKRTKKIALIVLKYVLPLIVSTVLIVITIIMYIRCRNRSTKKSDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK
**F*GNYALCGPPKLRVPPCKPDNSKRTKKIALIVLKYVLPLIVSTVLIVITIIMYIRCRNRST********LPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ESFFGNYALCGPPKLRVPPCKPDNSKRTKKIALIVLKYVLPLIVSTVLIVITIIMYIRCRNRSTKKSDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
Q8W4S5 614 Probable LRR receptor-lik yes no 0.950 0.187 0.330 2e-09
C0LGU5 614 Probable LRR receptor-lik no no 0.950 0.187 0.312 2e-09
C0LGX1 607 Probable LRR receptor-lik no no 0.355 0.070 0.604 7e-09
Q9LFS4 638 Protein NSP-INTERACTING K no no 0.768 0.145 0.36 1e-08
Q9ZP16 667 Cysteine-rich receptor-li no no 0.834 0.151 0.303 2e-08
Q8GYA4 669 Cysteine-rich receptor-li no no 0.322 0.058 0.641 1e-07
C0LGD7 953 Probable LRR receptor-lik no no 0.983 0.124 0.341 1e-07
Q8W4G6 627 Cysteine-rich receptor-li no no 0.719 0.138 0.351 2e-07
Q9LFG1 937 Putative leucine-rich rep no no 0.958 0.123 0.309 3e-07
Q9C5S8 659 Cysteine-rich receptor-li no no 0.628 0.115 0.376 3e-07
>sp|Q8W4S5|Y5371_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g63710 OS=Arabidopsis thaliana GN=At5g63710 PE=2 SV=1 Back     alignment and function desciption
 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 61/130 (46%), Gaps = 15/130 (11%)

Query: 3   FFGNYALCGPPKLRVPPCKPDN----SKRTKKIALIVLKYVLPLIVSTVLIVITIIMYIR 58
           F G   +CG  K    PC   +    +   KK+  I L      + S +L +  ++MY  
Sbjct: 192 FSGTQLICG--KSLNQPCSSSSRLPVTSSKKKLRDITL--TASCVASIILFLGAMVMYHH 247

Query: 59  CRNRSTK-------KSDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGT 111
            R R TK         + +  +     +R S  +IQ ATD FNE NL+G G FG VY+G 
Sbjct: 248 HRVRRTKYDIFFDVAGEDDRKISFGQLKRFSLREIQLATDSFNESNLIGQGGFGKVYRGL 307

Query: 112 ISDGTDVAIK 121
           + D T VA+K
Sbjct: 308 LPDKTKVAVK 317





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGU5|Y5457_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g45780 OS=Arabidopsis thaliana GN=At5g45780 PE=2 SV=1 Back     alignment and function description
>sp|C0LGX1|Y5524_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g65240 OS=Arabidopsis thaliana GN=At5g65240 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFS4|NIK1_ARATH Protein NSP-INTERACTING KINASE 1 OS=Arabidopsis thaliana GN=NIK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZP16|CRK11_ARATH Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2 Back     alignment and function description
>sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=3 Back     alignment and function description
>sp|C0LGD7|Y1684_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=1 SV=2 Back     alignment and function description
>sp|Q8W4G6|CRK15_ARATH Cysteine-rich receptor-like protein kinase 15 OS=Arabidopsis thaliana GN=CRK15 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFG1|Y3359_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590 OS=Arabidopsis thaliana GN=At3g53590 PE=3 SV=2 Back     alignment and function description
>sp|Q9C5S8|CRK5_ARATH Cysteine-rich receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
255572272 1089 serine-threonine protein kinase, plant-t 1.0 0.111 0.540 3e-27
359483198 1087 PREDICTED: probable LRR receptor-like se 0.991 0.110 0.479 6e-26
224116832 1061 predicted protein [Populus trichocarpa] 0.983 0.112 0.487 4e-25
255578886 1043 serine-threonine protein kinase, plant-t 0.983 0.114 0.483 4e-24
255577015 250 serine-threonine protein kinase, plant-t 0.991 0.48 0.466 5e-23
255583725 973 serine-threonine protein kinase, plant-t 0.983 0.122 0.467 2e-22
224139658 1019 predicted protein [Populus trichocarpa] 0.983 0.116 0.45 2e-21
359482811 1118 PREDICTED: probable LRR receptor-like se 0.991 0.107 0.471 3e-20
147774645 1049 hypothetical protein VITISV_011744 [Viti 0.991 0.114 0.471 3e-20
255585401 843 serine-threonine protein kinase, plant-t 0.966 0.138 0.416 3e-20
>gi|255572272|ref|XP_002527075.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533580|gb|EEF35319.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 82/122 (67%), Gaps = 1/122 (0%)

Query: 1   ESFFGNYALCGPPKLRVPPCKPDNSKRTKKI-ALIVLKYVLPLIVSTVLIVITIIMYIRC 59
           +SF GN ALCG  +L+V PCK DNS+ T+   + IVL+YVLP IV  V ++  +IM  R 
Sbjct: 709 QSFIGNEALCGSARLQVSPCKDDNSRATETPGSKIVLRYVLPAIVFAVFVLAFVIMLKRY 768

Query: 60  RNRSTKKSDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVA 119
             R  K S  +DFL L T RR SY ++Q AT+ F E N LG GSFGSVYKGT+SDGT +A
Sbjct: 769 CERKAKFSIEDDFLALTTIRRISYHELQLATNGFQESNFLGMGSFGSVYKGTLSDGTVIA 828

Query: 120 IK 121
            K
Sbjct: 829 AK 830




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359483198|ref|XP_002271405.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116832|ref|XP_002317405.1| predicted protein [Populus trichocarpa] gi|222860470|gb|EEE98017.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255578886|ref|XP_002530297.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223530195|gb|EEF32104.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255577015|ref|XP_002529392.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223531140|gb|EEF32988.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255583725|ref|XP_002532616.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527672|gb|EEF29782.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224139658|ref|XP_002323215.1| predicted protein [Populus trichocarpa] gi|222867845|gb|EEF04976.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482811|ref|XP_002270207.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147774645|emb|CAN69907.1| hypothetical protein VITISV_011744 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255585401|ref|XP_002533396.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526770|gb|EEF28996.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TAIR|locus:2026097 628 SERK2 "somatic embryogenesis r 0.388 0.074 0.510 1.3e-08
TAIR|locus:2121676 669 CRK10 "cysteine-rich RLK (RECE 0.909 0.164 0.327 1.5e-08
TAIR|locus:2131694 815 AT4G27300 [Arabidopsis thalian 0.504 0.074 0.406 1.1e-07
TAIR|locus:2013021 625 SERK1 "somatic embryogenesis r 0.388 0.075 0.489 1.9e-07
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.983 0.116 0.302 1.9e-07
TAIR|locus:2159873 681 PERK8 "proline-rich extensin-l 0.330 0.058 0.55 2.9e-07
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.909 0.093 0.320 3.7e-07
TAIR|locus:2026821 649 CRK2 "cysteine-rich RLK (RECEP 0.545 0.101 0.378 4.1e-07
TAIR|locus:2121636 659 CRK7 "cysteine-rich RLK (RECEP 0.975 0.179 0.278 4.8e-07
TAIR|locus:2146102 638 NIK1 "NSP-interacting kinase 1 0.471 0.089 0.421 5.9e-07
TAIR|locus:2026097 SERK2 "somatic embryogenesis receptor-like kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 120 (47.3 bits), Expect = 1.3e-08, Sum P(2) = 1.3e-08
 Identities = 24/47 (51%), Positives = 32/47 (68%)

Query:    75 LATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK 121
             L   +R S  ++Q ATD F+  N+LG G FG VYKG ++DGT VA+K
Sbjct:   287 LGQLKRFSLRELQVATDSFSNKNILGRGGFGKVYKGRLADGTLVAVK 333


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009556 "microsporogenesis" evidence=IGI;IMP
GO:0010152 "pollen maturation" evidence=IMP
GO:0033612 "receptor serine/threonine kinase binding" evidence=IPI
GO:0009742 "brassinosteroid mediated signaling pathway" evidence=IMP
TAIR|locus:2121676 CRK10 "cysteine-rich RLK (RECEPTOR-like protein kinase) 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131694 AT4G27300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013021 SERK1 "somatic embryogenesis receptor-like kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159873 PERK8 "proline-rich extensin-like receptor kinase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026821 CRK2 "cysteine-rich RLK (RECEPTOR-like protein kinase) 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121636 CRK7 "cysteine-rich RLK (RECEPTOR-like protein kinase) 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146102 NIK1 "NSP-interacting kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00025215001
SubName- Full=Chromosome chr9 scaffold_33, whole genome shotgun sequence; (691 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 6e-04
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 0.002
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.003
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 0.003
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 0.003
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 0.003
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 0.004
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
 Score = 37.3 bits (86), Expect = 6e-04
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 98  LLGTGSFGSVYKGTISDGTDVAIK 121
           LLG G+FG V+KGT+ D T VA+K
Sbjct: 2   LLGKGNFGEVFKGTLKDKTPVAVK 25


Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-cell interactions mediated by adherens junctions and focal adhesions. Fer kinase also regulates cell cycle progression in malignant cells. Length = 250

>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.18
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.12
KOG3653 534 consensus Transforming growth factor beta/activin 98.72
KOG2052 513 consensus Activin A type IB receptor, serine/threo 98.31
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 98.09
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 97.63
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 97.34
PLN03224 507 probable serine/threonine protein kinase; Provisio 97.14
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 97.04
cd05144 198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 96.6
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 96.46
PRK09188 365 serine/threonine protein kinase; Provisional 96.43
PTZ00284 467 protein kinase; Provisional 96.33
KOG0201 467 consensus Serine/threonine protein kinase [Signal 96.07
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 96.06
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 96.0
KOG0192 362 consensus Tyrosine kinase specific for activated ( 96.0
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 95.95
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 95.8
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 95.74
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 95.66
smart00090 237 RIO RIO-like kinase. 95.65
PTZ00036 440 glycogen synthase kinase; Provisional 95.54
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 95.44
PLN00034 353 mitogen-activated protein kinase kinase; Provision 95.39
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 95.38
PLN03150623 hypothetical protein; Provisional 95.36
PHA02882 294 putative serine/threonine kinase; Provisional 95.31
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 95.3
PTZ00283 496 serine/threonine protein kinase; Provisional 95.23
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 95.2
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 95.16
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 95.1
PTZ00263 329 protein kinase A catalytic subunit; Provisional 95.08
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 95.06
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 95.05
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 95.01
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 94.99
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 94.97
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 94.95
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 94.92
KOG0575 592 consensus Polo-like serine/threonine protein kinas 94.91
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 94.89
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 94.86
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 94.8
PHA02988 283 hypothetical protein; Provisional 94.73
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 94.62
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 94.61
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 94.61
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 94.57
PF15102146 TMEM154: TMEM154 protein family 94.53
PF1457575 EphA2_TM: Ephrin type-A receptor 2 transmembrane d 94.4
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 94.31
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 94.3
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 94.21
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 94.2
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 94.03
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 94.02
PHA03209 357 serine/threonine kinase US3; Provisional 94.01
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 93.87
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 93.84
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 93.74
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 93.66
KOG0605 550 consensus NDR and related serine/threonine kinases 93.64
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 93.62
PHA03212 391 serine/threonine kinase US3; Provisional 93.52
KOG0694 694 consensus Serine/threonine protein kinase [Signal 93.5
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 93.43
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 93.32
KOG0577 948 consensus Serine/threonine protein kinase [Signal 93.29
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 93.27
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 93.15
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 93.11
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 93.04
KOG0198 313 consensus MEKK and related serine/threonine protei 93.0
PHA03211 461 serine/threonine kinase US3; Provisional 92.98
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 92.97
PRK09605 535 bifunctional UGMP family protein/serine/threonine 92.93
KOG42581025 consensus Insulin/growth factor receptor (contains 92.73
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 92.54
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 92.13
KOG1027 903 consensus Serine/threonine protein kinase and endo 91.98
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 91.98
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 91.83
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 91.46
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 91.19
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 91.06
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 90.98
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 90.87
COG0661 517 AarF Predicted unusual protein kinase [General fun 90.79
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 90.78
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 90.7
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 90.61
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 90.53
KOG0598 357 consensus Ribosomal protein S6 kinase and related 90.44
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 90.35
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 90.17
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 90.11
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 89.93
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 89.89
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 89.8
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 89.72
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 89.69
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 89.49
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 89.1
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 88.89
PF14610189 DUF4448: Protein of unknown function (DUF4448) 88.8
KOG0581 364 consensus Mitogen-activated protein kinase kinase 88.77
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 88.73
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 88.5
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 88.42
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 88.21
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 88.13
KOG0583 370 consensus Serine/threonine protein kinase [Signal 88.09
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 87.64
PTZ00266 1021 NIMA-related protein kinase; Provisional 87.2
KOG1167 418 consensus Serine/threonine protein kinase of the C 87.13
PF12877 684 DUF3827: Domain of unknown function (DUF3827); Int 86.72
PF08374221 Protocadherin: Protocadherin; InterPro: IPR013585 86.24
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 85.81
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 85.38
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 85.36
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 85.16
COG0478 304 RIO-like serine/threonine protein kinase fused to 84.95
PHA03207 392 serine/threonine kinase US3; Provisional 84.73
KOG1235 538 consensus Predicted unusual protein kinase [Genera 83.83
KOG1989 738 consensus ARK protein kinase family [Signal transd 82.98
KOG0582 516 consensus Ste20-like serine/threonine protein kina 82.88
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 82.62
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 82.45
PF06365202 CD34_antigen: CD34/Podocalyxin family; InterPro: I 82.22
PHA03210 501 serine/threonine kinase US3; Provisional 81.22
PF15050133 SCIMP: SCIMP protein 81.08
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 81.01
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 80.89
PF01299306 Lamp: Lysosome-associated membrane glycoprotein (L 80.7
PTZ00267 478 NIMA-related protein kinase; Provisional 80.59
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.18  E-value=2.9e-10  Score=86.86  Aligned_cols=32  Identities=28%  Similarity=0.554  Sum_probs=27.5

Q ss_pred             hccCCcCceeccCCcceeEEEEe-CCCCEEEeC
Q 037933           90 TDEFNECNLLGTGSFGSVYKGTI-SDGTDVAIK  121 (121)
Q Consensus        90 ~~~~~~~~~ig~g~~g~vykg~l-~~g~~vavK  121 (121)
                      ...+.+.++||+|+||.||+|.. .++..||||
T Consensus       689 ~~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK  721 (968)
T PLN00113        689 LSSLKEENVISRGKKGASYKGKSIKNGMQFVVK  721 (968)
T ss_pred             HhhCCcccEEccCCCeeEEEEEECCCCcEEEEE
Confidence            34578888999999999999987 578889987



>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG4258 consensus Insulin/growth factor receptor (contains protein kinase domain) [Signal transduction mechanisms] Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>PF14610 DUF4448: Protein of unknown function (DUF4448) Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>PF12877 DUF3827: Domain of unknown function (DUF3827); InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>PF06365 CD34_antigen: CD34/Podocalyxin family; InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PF15050 SCIMP: SCIMP protein Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 3e-07
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 2e-06
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 1e-05
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 1e-05
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 50.4 bits (119), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 23/47 (48%), Positives = 32/47 (68%) Query: 75 LATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK 121 L +R S ++Q A+D F+ N+LG G FG VYKG ++DGT VA+K Sbjct: 22 LGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVK 68
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 8e-16
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 9e-16
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 6e-10
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 3e-07
3soc_A 322 Activin receptor type-2A; structural genomics cons 4e-07
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 5e-06
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 5e-06
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 3e-05
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-05
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 7e-05
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-05
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 8e-05
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 8e-05
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 1e-04
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 1e-04
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-04
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-04
2a19_B 284 Interferon-induced, double-stranded RNA-activated 2e-04
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-04
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 2e-04
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 2e-04
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-04
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 2e-04
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 3e-04
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 3e-04
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-04
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 4e-04
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 4e-04
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 4e-04
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-04
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 4e-04
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 5e-04
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 5e-04
3q4u_A 301 Activin receptor type-1; structural genomics conso 5e-04
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 6e-04
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 6e-04
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 6e-04
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 6e-04
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 7e-04
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 7e-04
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 7e-04
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 7e-04
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 8e-04
3pls_A 298 Macrophage-stimulating protein receptor; protein k 8e-04
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 8e-04
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 8e-04
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 9e-04
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 9e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
 Score = 70.7 bits (174), Expect = 8e-16
 Identities = 23/55 (41%), Positives = 36/55 (65%)

Query: 67  SDHEDFLPLATWRRTSYLDIQRATDEFNECNLLGTGSFGSVYKGTISDGTDVAIK 121
           ++ +  + L   +R S  ++Q A+D F+  N+LG G FG VYKG ++DGT VA+K
Sbjct: 6   AEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVK 60


>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 97.97
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 97.94
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.61
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 97.58
4aoj_A 329 High affinity nerve growth factor receptor; transf 97.53
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.43
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 97.36
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.15
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 97.08
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 97.05
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 96.98
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 96.92
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 96.92
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 96.9
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 96.83
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 96.81
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 96.8
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 96.78
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 96.72
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 96.71
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 96.69
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 96.66
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 96.6
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 96.54
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 96.54
3niz_A 311 Rhodanese family protein; structural genomics, str 96.53
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 96.53
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 96.49
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 96.48
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 96.45
3soc_A 322 Activin receptor type-2A; structural genomics cons 96.44
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 96.43
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 96.41
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 96.38
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 96.38
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 96.36
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 96.35
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 96.33
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 96.32
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 96.31
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 96.31
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 96.3
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 96.29
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 96.25
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 96.25
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 96.24
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 96.22
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 96.19
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 96.18
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 96.18
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 96.17
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 96.14
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 96.13
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 96.13
3aln_A 327 Dual specificity mitogen-activated protein kinase; 96.09
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 96.07
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 96.06
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 96.06
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 96.05
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 96.03
3an0_A 340 Dual specificity mitogen-activated protein kinase; 96.03
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 95.95
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 95.92
2a19_B 284 Interferon-induced, double-stranded RNA-activated 95.92
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 95.92
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 95.91
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 95.89
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 95.89
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 95.88
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 95.87
3uqc_A 286 Probable conserved transmembrane protein; structur 95.87
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 95.86
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 95.85
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 95.84
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 95.84
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 95.84
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 95.83
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 95.83
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 95.82
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 95.79
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 95.77
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 95.75
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 95.75
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 95.74
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 95.73
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 95.71
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 95.7
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 95.7
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 95.7
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 95.69
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 95.69
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 95.67
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 95.66
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 95.63
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 95.61
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 95.61
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 95.57
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 95.55
2dyl_A 318 Dual specificity mitogen-activated protein kinase 95.55
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 95.54
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 95.54
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 95.54
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 95.54
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 95.52
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 95.51
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 95.5
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 95.49
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 95.49
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 95.48
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 95.48
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 95.46
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 95.44
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 95.44
3rp9_A 458 Mitogen-activated protein kinase; structural genom 95.44
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 95.43
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 95.42
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 95.42
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 95.41
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 95.41
3ork_A 311 Serine/threonine protein kinase; structural genomi 95.41
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 95.4
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 95.39
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 95.39
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 95.39
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 95.38
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 95.36
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 95.35
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 95.35
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 95.34
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 95.33
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 95.33
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 95.33
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 95.32
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 95.31
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 95.31
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 95.28
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 95.26
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 95.25
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 95.24
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 95.24
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 95.22
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 95.21
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 95.19
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 95.17
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 95.16
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 95.15
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 95.14
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 95.13
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 95.13
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 95.12
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 95.12
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 95.1
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 95.08
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 95.05
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 95.04
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 95.03
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 95.01
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 95.01
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 95.0
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 95.0
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 95.0
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 94.96
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 94.95
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 94.9
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 94.89
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 94.87
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 94.86
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 94.84
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 94.8
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 94.79
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 94.77
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 94.74
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 94.73
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 94.7
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 94.69
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 94.69
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 94.69
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 94.64
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 94.64
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 94.64
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 94.64
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 94.63
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 94.63
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 94.59
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 94.57
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 94.56
3pls_A 298 Macrophage-stimulating protein receptor; protein k 94.54
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 94.51
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 94.46
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 94.37
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 94.31
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 94.27
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 94.26
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 94.16
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 94.14
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 94.08
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 94.01
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 93.96
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 93.94
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 93.86
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 93.79
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 93.58
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 93.45
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 93.23
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 93.01
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 92.55
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
Probab=97.97  E-value=8.6e-06  Score=53.62  Aligned_cols=44  Identities=39%  Similarity=0.776  Sum_probs=38.8

Q ss_pred             cccccCHHHHHHhhccCCcC------ceeccCCcceeEEEEeCCCCEEEeC
Q 037933           77 TWRRTSYLDIQRATDEFNEC------NLLGTGSFGSVYKGTISDGTDVAIK  121 (121)
Q Consensus        77 ~~~~~~~~~l~~~~~~~~~~------~~ig~g~~g~vykg~l~~g~~vavK  121 (121)
                      ....+++.++..++++|++.      +.||+|+||.||+|.. ++..+|||
T Consensus        11 ~~~~~~~~~l~~~~~~f~~~~~~~~~~~lg~G~~g~Vy~~~~-~~~~vavK   60 (307)
T 2nru_A           11 RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYV-NNTTVAVK   60 (307)
T ss_dssp             CCEECCHHHHHHHTTTTCCSBTTTTCCEEEECSSEEEEEEES-SSCEEEEE
T ss_pred             CCCcccHHHHHHHHcccccccccccCCccccCCCeEEEEEEE-CCceEEEE
Confidence            34678999999999999988      8899999999999997 67788886



>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-07
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 7e-07
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 7e-07
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-06
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-06
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-06
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-05
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-05
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-05
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-05
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-05
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-05
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-05
d1zara2 191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 3e-05
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-05
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-05
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-05
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-05
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-05
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-05
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-05
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-05
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 6e-05
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 7e-05
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 8e-05
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 8e-05
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 8e-05
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-04
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-04
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-04
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-04
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-04
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-04
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-04
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-04
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-04
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-04
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-04
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-04
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-04
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 3e-04
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-04
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-04
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-04
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 3e-04
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-04
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 4e-04
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-04
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 4e-04
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 5e-04
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 6e-04
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 6e-04
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-04
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 8e-04
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 9e-04
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 9e-04
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 0.001
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 0.001
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 0.002
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 0.002
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 0.003
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 0.003
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.6 bits (105), Expect = 4e-07
 Identities = 11/31 (35%), Positives = 15/31 (48%)

Query: 91  DEFNECNLLGTGSFGSVYKGTISDGTDVAIK 121
           +       LG G FG V+ G  +  T VA+K
Sbjct: 13  ETLKLVERLGAGQFGEVWMGYYNGHTKVAVK 43


>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 98.01
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 97.85
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 97.61
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 97.55
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 97.51
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 97.37
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 97.25
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 97.25
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 97.19
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 97.1
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 96.97
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 96.96
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 96.95
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 96.92
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 96.9
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 96.85
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 96.84
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 96.83
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 96.77
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 96.72
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 96.69
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 96.68
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 96.6
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 96.57
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 96.42
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.01  E-value=8.1e-07  Score=57.48  Aligned_cols=43  Identities=35%  Similarity=0.543  Sum_probs=31.4

Q ss_pred             cccCHHHHHHhhccCCc---------CceeccCCcceeEEEEeCC-C---CEEEeC
Q 037933           79 RRTSYLDIQRATDEFNE---------CNLLGTGSFGSVYKGTISD-G---TDVAIK  121 (121)
Q Consensus        79 ~~~~~~~l~~~~~~~~~---------~~~ig~g~~g~vykg~l~~-g---~~vavK  121 (121)
                      +.++|+++..++.+|..         .++||+|+||+||+|.... +   ..||||
T Consensus         5 d~~t~~d~~~a~~~f~~~i~~~~~~~~~~lG~G~fg~Vy~~~~~~~~~~~~~vavK   60 (299)
T d1jpaa_           5 DPFTFEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIK   60 (299)
T ss_dssp             CGGGSSSHHHHHHHHSCBCCGGGEEEEEEEEECSSSEEEEEEECC---CCEEEEEE
T ss_pred             CCCCHHHHHHHHhhhchhhChhhcEEeeEEeeCCCeEEEEEEEeCCCCEEEEEEEE
Confidence            35667777777777654         3589999999999998742 2   357776



>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure