Citrus Sinensis ID: 037939


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MGSLLSLILTILSLASLSETQGVKSTRVLDLLIRDYTFKSLDNHAIKTGNLHNVHLPANLSGIKVDMVRFRCGSLRRYGARVKEFHLGIGVIVQPCVERVVVVRQNLGYNWSSIYYANYDLSGYQLVSPVLGILAYNSVTDVNFNNRFELQILANGKPITIDFRNTTRVTNISGIKPFCANFQRDGKVTLTNQVSPYVCVARKHGHFGLVTKYPPPSEGPEQVRKKISRWKLAVGTTVGAAVGAFLLGLLLVAMFVKVKKKARMEELERRAYEEEALQVSMVGHIRAPTASVTRTVPTIEQYEYIPYRS
ccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccEEEEEEEEcccccccccEEEEEEEccccEEcccEEEEEEEEEcccccccccccccccccccEEEccEEEEEEEccccccccccccEEEEEEccccEEEEEccccccccccccccEEEEEEcccEEEEECcccccEEEEccccEEEEEEEccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccccc
**SLLSLILTILSLASLSETQGVKSTRVLDLLIRDYTFKSLDNHAIKTGNLHNVHLPANLSGIKVDMVRFRCGSLRRYGARVKEFHLGIGVIVQPCVERVVVVRQNLGYNWSSIYYANYDLSGYQLVSPVLGILAYNSVTDVNFNNRFELQILANGKPITIDFRNTTRVTNISGIKPFCANFQRDGKVTLTNQVSPYVCVARKHGHFGLVTKY*************ISRWKLAVGTTVGAAVGAFLLGLLLVAMFVKVKKKARM******AYEEEALQVSMVGHIRAPTASVTRTVPTIEQYEY*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLLSLILTILSLASLSETQGVKSTRVLDLLIRDYTFKSLDNHAIKTGNLHNVHLPANLSGIKVDMVRFRCGSLRRYGARVKEFHLGIGVIVQPCVERVVVVRQNLGYNWSSIYYANYDLSGYQLVSPVLGILAYNSVTDVNFNNRFELQILANGKPITIDFRNTTRVTNISGIKPFCANFQRDGKVTLTNQVSPYVCVARKHGHFGLVTKYPPPSEGPEQVRKKISRWKLAVGTTVGAAVGAFLLGLLLVAMFVxxxxxxxxxxxxxxxxxxxxxQVSMVGHIRAPTASVTRTVPTIEQYEYIPYRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DLO, chain A
Confidence level:probable
Coverage over the Query: 84-213
View the alignment between query and template
View the model in PyMOL
Template: 2L8S, chain A
Confidence level:probable
Coverage over the Query: 229-266
View the alignment between query and template
View the model in PyMOL
Template: 3UD1, chain A
Confidence level:probable
Coverage over the Query: 62-139,150-213
View the alignment between query and template
View the model in PyMOL