Citrus Sinensis ID: 037955

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730---
RRLPRTAAAPNQMWTLIRRTAPFVRCKSCYSDHSTTRHFYTRTSNGVPTGLYGFDHLKSPNGFQRFVDDAIERSSELVNYISEMPSSVEIIRAMDEISDAVCSVVDSAELCRQTHPDREFVEEASKASMRISEYLHYLNTNHTLYDAVKKAELDGHLLSKEAHRAANHLRIDFEKGGIHLCADKLDRVNQLNMDIFQLCREFNQNIINDPGHVDIFPESRIPKHIHHLLKPICRLTSGPSRESLISWDNKKEKGFRITTDSRILQSILQWTSDDEVRKMVYIQGHSVPQANHEVLHELIAARNELAQIMGYRSYAEFIVMPNMASSPEVVKSFLLEMSKMIKPKADEEFEAIKNFKRKSCGQKYVHLEPWDEAYYTAMMKSSAYNLDACVVASYFPLGQCIEGLKMLAESLFGVTFHSVPLAPGESWHPDVLKLSLQHPEEGEMGYLYLDLYSRAGKYTGCANFAIKGGRRLSETEYQLPVVALICNFPGSHNLSVRLNHHEVETLFHEFGHALHSLLSRTDYQHFSGTRVALDFAETPSNLFEYYAWDYRVLRRFAKHYLTGEIVPEKLVKSMQGARDMFAATELQRQIFYALVDQTLFGERLGQTRDTSSIVADMKRQHTSWNHVEGTHWHIRFSHFINYGAGYYSYLYAKCFAATIWQKLCQEDPLSLTTGTTLRTKILQHGGAKEPADMLNDLVGDGILRYCNGGIVPDITSFSDEVKLMEDKQEQILL
ccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEECcccccccccccccHHccccccHHHHHHHHHHccccccEEEEcccccHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccEEEECcccccccccccccEEEEECccccEEEEEEEEcccccccccccccccccccEEcccccEEccEEEEEccccccccccccccccHHHHHHHHHcHHHHHHHcccccccccccccccccccccHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccHHHHHHHcccccccHHHccc
***********QMWTLIRRTAPFVRCKSCYSDHSTTRHFYTRTSNGVPTGLYGFDHLKSPNGFQRFVDDAIERSSELVNYISEMPSSVEIIRAMDEISDAVCSVVDSAELCRQTHPDREFVEEASKASMRISEYLHYLNTNHTLYDAVKKAELDGHLLSKEAHRAANHLRIDFEKGGIHLCADKLDRVNQLNMDIFQLCREFNQNIINDPGHVDIFPESRIPKHIHHLLKPICRLTSGP*RESLISWDNKKEKGFRITTDSRILQSILQWTSDDEVRKMVYIQGHSVPQANHEVLHELIAARNELAQIMGYRSYAEFIVMPNMASSPEVVKSFLLEMSKMIKPKADEEFEAIKNFKRKSCGQKYVHLEPWDEAYYTAMMKSSAYNLDACVVASYFPLGQCIEGLKMLAESLFGVTFHSVPLAPGESWHPDVLKLSLQHPEEGEMGYLYLDLYSRAGKYTGCANFAIKGGRRLSETEYQLPVVALICNFPGSHNLSVRLNHHEVETLFHEFGHALHSLLSRTDYQHFSGTRVALDFAETPSNLFEYYAWDYRVLRRFAKHYLTGEIVPEKLVKSMQGARDMFAATELQRQIFYALVDQTLFGERLGQTRDTSSIVADMKRQHTSWNHVEGTHWHIRFSHFINYGAGYYSYLYAKCFAATIWQKLCQEDPLSLTTGTTLRTKILQHGGAKEPADMLNDLVGDGILRYCNGGIVPDITSFSDEVKLMED****ILL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RRLPRTAAAPNQMWTLIRRTAPFVRCKSCYSDHSTTRHFYTRTSNGVPTGLYGFDHLKSPNGFQRFVDDAIERSSELVNYISEMPSSVEIIRAMDEISDAVCSVVDSAELCRQTHPDREFVEEASKASMRISEYLHYLNTNHTLYDAVKKAELDGHLLSKEAHRAANHLRIDFEKGGIHLCADKLDRVNQLNMDIFQLCREFNQNIINDPGHVDIFPESRIPKHIHHLLKPICRLTSGPSRESLISWDNKKEKGFRITTDSRILQSILQWTSDDEVRKMVYIQGHSVPQANHEVLHELIAARNELAQIMGYRSYAEFIVMPNMASSPEVVKSFLLEMSKMIKPKADEEFEAIKNFKRKSCGQKYVHLEPWDEAYYTAMMKSSAYNLDACVVASYFPLGQCIEGLKMLAESLFGVTFHSVPLAPGESWHPDVLKLSLQHPEEGEMGYLYLDLYSRAGKYTGCANFAIKGGRRLSETEYQLPVVALICNFPGSHNLSVRLNHHEVETLFHEFGHALHSLLSRTDYQHFSGTRVALDFAETPSNLFEYYAWDYRVLRRFAKHYLTGEIVPEKLVKSMQGARDMFAATELQRQIFYALVDQTLFGERLGQTRDTSSIVADMKRQHTSWNHVEGTHWHIRFSHFINYGAGYYSYLYAKCFAATIWQKLCQEDPLSLTTGTTLRTKILQHGGAKEPADMLNDLVGDGILRYCNGGIVPDITSFSDEVKLMEDKQEQILL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial intermediate peptidase Cleaves proteins, imported into the mitochondrion, to their mature size. While most mitochondrial precursor proteins are processed to the mature form in one step by mitochondrial processing peptidase (MPP), the sequential cleavage by MIP of an octapeptide after initial processing by MPP is a required step for a subgroup of nuclear-encoded precursor proteins destined for the matrix or the inner membrane.probableQ6CVF7
Mitochondrial intermediate peptidase Cleaves proteins, imported into the mitochondrion, to their mature size. While most mitochondrial precursor proteins are processed to the mature form in one step by mitochondrial processing peptidase (MPP), the sequential cleavage by MIP of an octapeptide after initial processing by MPP is a required step for a subgroup of nuclear-encoded precursor proteins destined for the matrix or the inner membrane.probableQ753X4
Mitochondrial intermediate peptidase Cleaves proteins, imported into the mitochondrion, to their mature size. While most mitochondrial precursor proteins are processed to the mature form in one step by mitochondrial processing peptidase (MPP), the sequential cleavage by MIP of an octapeptide after initial processing by MPP is a required step for a subgroup of nuclear-encoded precursor proteins destined for the matrix or the inner membrane. Cleaves precursor proteins of respiratory components, including subunits of the electron transport chain and tricarboxylic acid cycle enzymes, and components of the mitochondrial genetic machinery, including ribosomal proteins, translation factors, and proteins required for mitochondrial DNA metabolism.probableP35999

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.24.-Metalloendopeptidases.probable
3.4.24.59Mitochondrial intermediate peptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y79, chain 1
Confidence level:very confident
Coverage over the Query: 49-233,248-700,711-724
View the alignment between query and template
View the model in PyMOL