Citrus Sinensis ID: 037978

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
ETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKRGNIGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAIAYSVAFIGPNTHEQLPSTDF
ccccccccccccHHHHHHHHHHHHHHHHHHEEEEECcccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHccccccCEEEEEHHHHHHHHHHHHHHHHccccccccccccccc
*****ALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKRGNIGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAIAYSVAFIGPN**********
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKRGNIGIIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWDNHWVYWLGPFIGAAIAAIAYSVAFIGPNTHEQLPSTDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable aquaporin TIP1-2 Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. May be involved in transport from the vacuolar compartment to the cytoplasm.probableQ94CS9
Aquaporin TIP1-3 Potential aquaporin, which may facilitate the transport of water and small neutral solutes across cell membranes.probableO82598

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IYZ, chain A
Confidence level:very confident
Coverage over the Query: 2-111
View the alignment between query and template
View the model in PyMOL