Citrus Sinensis ID: 038053


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MSSGMGERVIDGDWKPTSSSNGKRTVVLLGRTGNGKSATGNSILGRKAFKASADSSGVTKTCEMKTTVLKDGQVVNVIDTPGLFDSSAGSEFVGKEIVKRIGLAKGGIHAVLVVFSVRSRFSQEEEAANGGQPYTDEFLAELKRGATELRDQQAEVDSLKEYSKQEISKLMGQMQESYEDQIKRITEMVESELKETTTRLEQQLAEEQAARLMAEEVAQLAQMKSTKFKLG
cccccccccccccccccccccccEEEEEEcccccccHHHHHHHcccccccccccccccccEEEEEEEEECccCEEEEEccccccccccccHHHHHHHHHHHHccccccEEEEEEEEccccccHHHHHHcccHHHHHHHHHHHHHcEEEEEcccccHHHHHHHcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccc
*************************VVLLGRTGNGKSATGNSILGRKAFKASADSSGVTKTCEMKTTVLKDGQVVNVIDTPGLFDSSAGSEFVGKEIVKRIGLAKGGIHAVLVVFSVRSRFSQEEEAANGGQPYTDEFLAELKRGATELRDQQAEVDSLKEYSKQEISKLMGQMQESYEDQIKRIT*****ELKETTTRLEQQLAEEQAARLMAE*********S**F***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSGMGERVIDGDWKPTSSSNGKRTVVLLGRTGNGKSATGNSILGRKAFKASADSSGVTKTCEMKTTVLKDGQVVNVIDTPGLFDSSAGSEFVGKEIVKRIGLAKGGIHAVLVVFSVRSRFSQEEEAANGGQPYTDEFLAELKRGATELRDQQAEVDSLKEYSKQEISKLMGQMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLMAEEVAQLAQMKSTKFKLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LXX, chain A
Confidence level:very confident
Coverage over the Query: 22-125
View the alignment between query and template
View the model in PyMOL
Template: 2XTP, chain A
Confidence level:very confident
Coverage over the Query: 23-178
View the alignment between query and template
View the model in PyMOL
Template: 2IT1, chain A
Confidence level:confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL
Template: 3SZR, chain A
Confidence level:probable
Coverage over the Query: 168-206
View the alignment between query and template
View the model in PyMOL