Citrus Sinensis ID: 038067


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESESETENGNRNRNSEGNIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSAHENDSEVLLKSPGACDE
cccccccccHHHHcccccccccEEccccccHHHHHcccccccEEEcccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHccccccccEEEEEEccccccccccccHHHHccccccccccccccccccccccccccEEEEccCEEEEccccccHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHccccHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccCEEEEEccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHcccccHHHHcccccccccccccEEEcccccHHHHHHHHccccHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccccccccccccEECccccHHHHHHHHccccccccccccccccccccc
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESE*******************TPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSL********LYVDSILGSGVKS****VE*DEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRA*****GLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGE****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESESETENGNRNRNSEGNIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSAHENDSEVLLKSPGACDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease ATP-binding subunit ClpX ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of ClpP.probableB2I3C2
ATP-dependent Clp protease ATP-binding subunit ClpX ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of ClpP.probableB0VKU4
ATP-dependent Clp protease ATP-binding subunit ClpX ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of ClpP.probableQ0VQ89

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UM8, chain A
Confidence level:very confident
Coverage over the Query: 70-95,111-134,153-240,254-271,289-472
View the alignment between query and template
View the model in PyMOL