Citrus Sinensis ID: 038067

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESESETENGNRNRNSEGNIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSAHENDSEVLLKSPGACDE
ccccccccHHHHHcccccccccEEccccccHHHHHcccccccEEEcccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHccccccccEEEEEEccccccccccccHHHHccccccccccccccccccccccccccEEEEccEEEEEccccccHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHccccHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHcccccHHHHcccccccccccccEEEcccccHHHHHHHHccccHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccccccccccccEEEccccHHHHHHHHccccccccccccccccccccc
cccccccccEEEEEcccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEHcccccEEEEccccccHHHHHHHHHHHHcccEEEEEHHHHcccccccccccHHHHHHHHHccccHHHHHHHcEEEEEcHHHHcccccccccHHHHHHHHHHHHHHHHccEEEcccccccccccccccEEEEccccEEEEEccHHHHHHHHHHHHcccccEccccEEcccccccccccHHHHHHHHHHccHHHHHHccccHHHHHHccEEEEcccccHHHHHHHHHcccccHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccEEEEEEHHHHccccccccHHHHcccccHHHHHHHHcccccccccccEccccccccc
avnfcpkcktafyfrpfkltplegsfielGKVKVEEIMGGFirkdgesngiesesetengnrnrnsegnidlptpkeiCKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYvdsilgsgvksgncnvendEIVELEksnvllmgptgsgkTLLAKTLARIVNVPFTITDATAltqagyvgeDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAEsrnngrdvsgEGVQQALLKMLEGtvvnvpipdngprkhprgdnipidtkdILFICGGAFVGLEKTiserrqdssigfgapvranmrtgglTDALVTSSllesvdsgdlvayglipefigrFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMfsmnnvklhfTDDALRLIAKKAMAKNTGARGLRALLENILTEAMfeipetkigtssvNAVLVdkeavgsvdapgcgakilhgdgeLERVLHETKsahendsevllkspgacde
avnfcpkcktafyfrpfkltpleGSFIELGKVKVEEIMGGfirkdgesngiesesetengnrnrnsegnidlptpkEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKaesrnngrdvsgEGVQQALLKMLEGTVVnvpipdngprkhprgdnipIDTKDILFICGGAFVGLEKTiserrqdssigfgapvranMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETksahendsevllkspgacde
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIesesetengnrnrnsegnIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSAHENDSEVLLKSPGACDE
**NFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIR*********************************EICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVK***************QQALLKMLEGTVVNVPI************NIPIDTKDILFICGGAFVGLEKTIS*******IGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGE****************************
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESE*******************TPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSL********LYVDSILGSGVKS****VE*DEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFG******************SSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKIL*********************************
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGES***************RNSEGNIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSAHENDSEVLLKSPGACDE
*VNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESESETENGNRN*****NIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHS********************************IVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRA*****GLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELER*************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESESETENGNRNRNSEGNIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIVKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSAHENDSEVLLKSPGACDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query510 2.2.26 [Sep-21-2011]
O67356412 ATP-dependent Clp proteas yes no 0.7 0.866 0.513 1e-103
Q6FEP7436 ATP-dependent Clp proteas yes no 0.678 0.793 0.508 1e-103
B0V4T7437 ATP-dependent Clp proteas yes no 0.674 0.787 0.507 1e-102
A3M1Y8437 ATP-dependent Clp proteas yes no 0.674 0.787 0.507 1e-102
B0VKU4437 ATP-dependent Clp proteas yes no 0.674 0.787 0.507 1e-102
B2I3C2437 ATP-dependent Clp proteas yes no 0.674 0.787 0.507 1e-102
B7I5E4437 ATP-dependent Clp proteas yes no 0.674 0.787 0.507 1e-102
B7H092437 ATP-dependent Clp proteas yes no 0.674 0.787 0.507 1e-102
A6U7U8425 ATP-dependent Clp proteas yes no 0.668 0.802 0.504 1e-101
Q92QQ2425 ATP-dependent Clp proteas yes no 0.668 0.802 0.504 1e-101
>sp|O67356|CLPX_AQUAE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aquifex aeolicus (strain VF5) GN=clpX PE=3 SV=1 Back     alignment and function desciption
 Score =  376 bits (966), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 213/415 (51%), Positives = 274/415 (66%), Gaps = 58/415 (13%)

Query: 58  ENGNRNRNSEGNIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYN 117
           EN   + N E   D+P P++I K LDE+VIGQERAKK     IL            AVYN
Sbjct: 46  ENKKTSYNFELK-DIPKPEQIKKILDEYVIGQERAKK-----IL----------SVAVYN 89

Query: 118 HYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKT 177
           HYKRI                        K+    +  D+ VELEKSN+LL+GPTGSGKT
Sbjct: 90  HYKRI------------------------KAKEAGLSLDD-VELEKSNILLIGPTGSGKT 124

Query: 178 LLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEV 237
           LLA+TLA+I+NVPF I DAT+LT+AGYVGED E+VL +LL A D+DV+AAQ+GIVYIDE+
Sbjct: 125 LLARTLAKILNVPFAIADATSLTEAGYVGEDVENVLVRLLQACDYDVKAAQKGIVYIDEI 184

Query: 238 DKIVKAESRNNG--RDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDI 295
           DKI K    N    RDVSGEGVQQALLK++EG+VVNVP P  G RKHP  + I +DT DI
Sbjct: 185 DKIAKKSGINPSITRDVSGEGVQQALLKIVEGSVVNVP-PQGG-RKHPHQEFIQVDTTDI 242

Query: 296 LFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAY 355
           LFICGGAFVGLE  I +R   S +GF A ++   +            LLE V+  DL+ +
Sbjct: 243 LFICGGAFVGLEDIIKQRLGKSRVGFEAEIKKVDK---------EQDLLELVEPDDLIRF 293

Query: 356 GLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLI 415
           G+IPEFIGRFP++ +L  L ED+LV++L+EPKNAL +QY+K+F +  VKL FT+ ALR I
Sbjct: 294 GMIPEFIGRFPVIATLRELTEDELVRILVEPKNALVKQYQKLFELEGVKLTFTEKALREI 353

Query: 416 AKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAP 470
           AK+A+ + TGARGLRA++E+I+ + MFE+P        V  V++D+  V + + P
Sbjct: 354 AKEAIRRKTGARGLRAIMEDIMADIMFEVP----SLPGVKEVIIDENVVKNKEKP 404
ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of ClpP.
Aquifex aeolicus (strain VF5) (taxid: 224324)
>sp|Q6FEP7|CLPX_ACIAD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter sp. (strain ADP1) GN=clpX PE=3 SV=1 Back     alignment and function description
>sp|B0V4T7|CLPX_ACIBY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AYE) GN=clpX PE=3 SV=1 Back     alignment and function description
>sp|A3M1Y8|CLPX_ACIBT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755) GN=clpX PE=3 SV=2 Back     alignment and function description
>sp|B0VKU4|CLPX_ACIBS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain SDF) GN=clpX PE=3 SV=1 Back     alignment and function description
>sp|B2I3C2|CLPX_ACIBC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ACICU) GN=clpX PE=3 SV=1 Back     alignment and function description
>sp|B7I5E4|CLPX_ACIB5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB0057) GN=clpX PE=3 SV=1 Back     alignment and function description
>sp|B7H092|CLPX_ACIB3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB307-0294) GN=clpX PE=3 SV=1 Back     alignment and function description
>sp|A6U7U8|CLPX_SINMW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sinorhizobium medicae (strain WSM419) GN=clpX PE=3 SV=1 Back     alignment and function description
>sp|Q92QQ2|CLPX_RHIME ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium meliloti (strain 1021) GN=clpX PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
255573808603 ATP-dependent clp protease ATP-binding s 0.907 0.767 0.714 0.0
297739450545 unnamed protein product [Vitis vinifera] 0.839 0.785 0.696 0.0
224129802521 predicted protein [Populus trichocarpa] 0.898 0.879 0.668 0.0
297734727562 unnamed protein product [Vitis vinifera] 0.927 0.841 0.682 1e-180
357149618 640 PREDICTED: ATP-dependent Clp protease AT 0.929 0.740 0.602 1e-175
413937331 642 hypothetical protein ZEAMMB73_870207 [Ze 0.907 0.721 0.615 1e-173
8978260608 CLP protease regulatory subunit CLPX-lik 0.913 0.766 0.630 1e-173
240256421608 ATP-dependent Clp protease [Arabidopsis 0.913 0.766 0.628 1e-173
297792267605 hypothetical protein ARALYDRAFT_495043 [ 0.901 0.760 0.637 1e-173
413937330 643 hypothetical protein ZEAMMB73_870207 [Ze 0.913 0.724 0.609 1e-173
>gi|255573808|ref|XP_002527823.1| ATP-dependent clp protease ATP-binding subunit clpx, putative [Ricinus communis] gi|223532747|gb|EEF34526.1| ATP-dependent clp protease ATP-binding subunit clpx, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/505 (71%), Positives = 403/505 (79%), Gaps = 42/505 (8%)

Query: 1   AVNFCPKCKTAFYFRPFKLTPLEGSFIELGKVKVEE------------IMGGFIRKD-GE 47
           AVNFCP CKTAFYFRPFKL PL+GSFIELG+VK  +              GG I KD G+
Sbjct: 99  AVNFCPNCKTAFYFRPFKLEPLQGSFIELGRVKGFDNGSCSSNNVNCKDTGGVIVKDCGK 158

Query: 48  SNGIESESETENGNRNRNSEGNIDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVY 107
               E   +  + + +   E   +LPTPKEICKGLDEFVIGQ+RAKK     +L      
Sbjct: 159 IGSFEVACDDVDDDDDVKLEN--ELPTPKEICKGLDEFVIGQDRAKK-----VLA----- 206

Query: 108 VIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVL 167
                 AVYNHYKRIYH S +KE  +D  Y DS             +++EIVEL+KSNVL
Sbjct: 207 -----VAVYNHYKRIYHGSKRKESGADMGYTDS-----------QNDDNEIVELDKSNVL 250

Query: 168 LMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAA 227
           LMGPTGSGKTLLAKTLAR+VNVPF I DAT LTQAGYVGED ES+LYKLLAA++F+VEAA
Sbjct: 251 LMGPTGSGKTLLAKTLARVVNVPFVIADATTLTQAGYVGEDVESILYKLLAASEFNVEAA 310

Query: 228 QRGIVYIDEVDKIVK-AESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGD 286
           QRGI+YIDEVDKI K AES N GRDVSGEGVQQALLKMLEGT+VNVP+PD GPRKHPRGD
Sbjct: 311 QRGIIYIDEVDKITKKAESSNIGRDVSGEGVQQALLKMLEGTIVNVPVPDKGPRKHPRGD 370

Query: 287 NIPIDTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLES 346
            I IDTKDILFICGGAFV LEKTISERRQD+SIGFGAPVR NMRTG + DA+V SSLLES
Sbjct: 371 PIQIDTKDILFICGGAFVDLEKTISERRQDASIGFGAPVRTNMRTGRMIDAVVASSLLES 430

Query: 347 VDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLH 406
           V+SGDLVAYGLIPEF+GRFPILVSLSALNEDQLVQVL+EPKNALG+QYKKMFSMN+VKLH
Sbjct: 431 VESGDLVAYGLIPEFVGRFPILVSLSALNEDQLVQVLVEPKNALGKQYKKMFSMNDVKLH 490

Query: 407 FTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGS 466
           FTD+ALRLIAKKAMAKNTGARGLRA+LE+ILTEAM+EIPE K G++ ++AVLVD+EAVGS
Sbjct: 491 FTDEALRLIAKKAMAKNTGARGLRAILESILTEAMYEIPENKTGSNCISAVLVDEEAVGS 550

Query: 467 VDAPGCGAKILHGDGELERVLHETK 491
            D PGCGAKILHGDG L    H TK
Sbjct: 551 ADEPGCGAKILHGDGALGCSFHATK 575

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297739450|emb|CBI29632.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224129802|ref|XP_002328806.1| predicted protein [Populus trichocarpa] gi|222839104|gb|EEE77455.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297734727|emb|CBI16961.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357149618|ref|XP_003575174.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpX-like isoform 1 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|413937331|gb|AFW71882.1| hypothetical protein ZEAMMB73_870207 [Zea mays] Back     alignment and taxonomy information
>gi|8978260|dbj|BAA98151.1| CLP protease regulatory subunit CLPX-like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240256421|ref|NP_568714.4| ATP-dependent Clp protease [Arabidopsis thaliana] gi|332008480|gb|AED95863.1| ATP-dependent Clp protease [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297792267|ref|XP_002864018.1| hypothetical protein ARALYDRAFT_495043 [Arabidopsis lyrata subsp. lyrata] gi|297309853|gb|EFH40277.1| hypothetical protein ARALYDRAFT_495043 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|413937330|gb|AFW71881.1| hypothetical protein ZEAMMB73_870207 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
TAIR|locus:2155446608 AT5G49840 [Arabidopsis thalian 0.731 0.613 0.684 4.7e-159
TAIR|locus:2006942656 AT1G33360 [Arabidopsis thalian 0.727 0.565 0.695 5.4e-155
TAIR|locus:2154257579 CLPX "CLP protease regulatory 0.717 0.632 0.707 5.9e-148
TIGR_CMR|SO_1795426 SO_1795 "ATP-dependent Clp pro 0.588 0.704 0.579 4.3e-94
UNIPROTKB|P0CAU2420 clpX "ATP-dependent Clp protea 0.578 0.702 0.576 3e-93
TIGR_CMR|SPO_1004424 SPO_1004 "ATP-dependent Clp pr 0.582 0.700 0.554 3.4e-92
TIGR_CMR|CPS_3784424 CPS_3784 "ATP-dependent Clp pr 0.601 0.724 0.538 1.5e-91
UNIPROTKB|Q9KQS7426 clpX "ATP-dependent Clp protea 0.592 0.708 0.550 4.9e-91
TIGR_CMR|VC_1921426 VC_1921 "ATP-dependent Clp pro 0.592 0.708 0.550 4.9e-91
UNIPROTKB|P0A6H1424 clpX "ClpX" [Escherichia coli 0.601 0.724 0.532 6.2e-91
TAIR|locus:2155446 AT5G49840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1304 (464.1 bits), Expect = 4.7e-159, Sum P(2) = 4.7e-159
 Identities = 267/390 (68%), Positives = 319/390 (81%)

Query:   114 AVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGNCNVENDEI--VELEKSNVLLMGP 171
             AVYNHYKRIYH+S +K             GS  +S N ++E+D I  VEL+KSNVLL+GP
Sbjct:   224 AVYNHYKRIYHASRKK-------------GSASESYNIDMEDDNIDHVELDKSNVLLLGP 270

Query:   172 TGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGI 231
             TGSGKTLLAKTLARIVNVPF I DAT+LTQA YVGED ES+LYKL   A  +VE AQRGI
Sbjct:   271 TGSGKTLLAKTLARIVNVPFAIADATSLTQASYVGEDVESILYKLYVEAGCNVEEAQRGI 330

Query:   232 VYIDEVDKI-VKAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPI 290
             VYIDEVDK+ +K+ S N GRDVSGEGVQQ+LLK+LEGTVV+VPIP+ G R+ PRGD+I +
Sbjct:   331 VYIDEVDKMTMKSHSSNGGRDVSGEGVQQSLLKLLEGTVVSVPIPEKGLRRDPRGDSIQM 390

Query:   291 DTKDILFICGGAFVGLEKTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSG 350
             DTKDILFICGGAF+ LEKT+SER+ D+SIGFGA VR NM T GL+ A VTSSLLES+ S 
Sbjct:   391 DTKDILFICGGAFIDLEKTVSERQHDASIGFGASVRTNMSTSGLSSAAVTSSLLESLQSE 450

Query:   351 DLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDD 410
             DLVAYGLIPEF+GR PILVSLSALNEDQLVQVL EPK+ALG+QYKK+F MNNV+L FT+ 
Sbjct:   451 DLVAYGLIPEFVGRLPILVSLSALNEDQLVQVLTEPKSALGKQYKKLFRMNNVQLQFTEG 510

Query:   411 ALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKI-GTSSVNAVLVDKEAVGSVDA 469
             A RLIA+KAM+KNTGARGLR++LE+ILTEAMFE+P++   G+ S+ AVLVD+EAVGSV +
Sbjct:   511 ATRLIARKAMSKNTGARGLRSILESILTEAMFEVPDSITEGSQSIKAVLVDEEAVGSVGS 570

Query:   470 PGCGAKILHGDGELERVLHETKSAHENDSE 499
             PGCGAKIL GD  L++ + E +S  ++  +
Sbjct:   571 PGCGAKILKGDNVLQQFVEEAESKEKSKED 600
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
TAIR|locus:2006942 AT1G33360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154257 CLPX "CLP protease regulatory subunit X" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1795 SO_1795 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|P0CAU2 clpX "ATP-dependent Clp protease ATP-binding subunit ClpX" [Caulobacter crescentus CB15 (taxid:190650)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1004 SPO_1004 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3784 CPS_3784 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQS7 clpX "ATP-dependent Clp protease ATP-binding subunit ClpX" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1921 VC_1921 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6H1 clpX "ClpX" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B2I3C2CLPX_ACIBCNo assigned EC number0.50760.67450.7871yesno
B0VKU4CLPX_ACIBSNo assigned EC number0.50760.67450.7871yesno
A4Y5I3CLPX_SHEPCNo assigned EC number0.51120.67450.8075yesno
B3PVY5CLPX_RHIE6No assigned EC number0.51260.66070.7929yesno
O67356CLPX_AQUAENo assigned EC number0.51320.70.8665yesno
B6ISY6CLPX_RHOCSNo assigned EC number0.50250.66070.8004yesno
A1RL88CLPX_SHESWNo assigned EC number0.51120.67450.8075yesno
Q07ZX9CLPX_SHEFNNo assigned EC number0.50370.67450.8075yesno
Q1MIM6CLPX_RHIL3No assigned EC number0.50760.66070.7929yesno
Q0VQ89CLPX_ALCBSNo assigned EC number0.50750.67640.8098yesno
B7I5E4CLPX_ACIB5No assigned EC number0.50760.67450.7871yesno
Q6FEP7CLPX_ACIADNo assigned EC number0.50880.67840.7935yesno
B0SZ62CLPX_CAUSKNo assigned EC number0.52250.62740.7619yesno
B0V4T7CLPX_ACIBYNo assigned EC number0.50760.67450.7871yesno
B7H092CLPX_ACIB3No assigned EC number0.50760.67450.7871yesno
A0KYL8CLPX_SHESANo assigned EC number0.50990.68030.8145yesno
A3M1Y8CLPX_ACIBTNo assigned EC number0.50760.67450.7871yesno
A1S4X6CLPX_SHEAMNo assigned EC number0.50370.67450.8094yesno
P0CAU2CLPX_CAUCRNo assigned EC number0.52510.62740.7619yesno
B8GX14CLPX_CAUCNNo assigned EC number0.52510.62740.7619yesno
Q2K9U6CLPX_RHIECNo assigned EC number0.51260.66070.7929yesno
C3MA45CLPX_RHISNNo assigned EC number0.50490.66860.8023yesno
Q2W3I0CLPX_MAGSANo assigned EC number0.50250.66070.8004yesno
B0TFI7CLPX_HELMINo assigned EC number0.51320.63330.7690yesno
B9JVD6CLPX_AGRVSNo assigned EC number0.50740.66860.8023yesno
Q8EG18CLPX_SHEONNo assigned EC number0.51230.68030.8145yesno
A6U7U8CLPX_SINMWNo assigned EC number0.50490.66860.8023yesno
Q8UFY5CLPX_AGRT5No assigned EC number0.5050.67250.8070yesno
Q92QQ2CLPX_RHIMENo assigned EC number0.50490.66860.8023yesno
B5ZY09CLPX_RHILWNo assigned EC number0.51010.66070.7929yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 0.0
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 1e-176
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 1e-151
COG1220444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ 2e-33
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 3e-33
TIGR00390441 TIGR00390, hslU, ATP-dependent protease HslVU, ATP 8e-28
PRK05201443 PRK05201, hslU, ATP-dependent protease ATP-binding 5e-22
smart0108690 smart01086, ClpB_D2-small, C-terminal, D2-small do 2e-18
COG1220444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ 3e-16
TIGR00390441 TIGR00390, hslU, ATP-dependent protease HslVU, ATP 4e-15
pfam00004131 pfam00004, AAA, ATPase family associated with vari 1e-14
PRK05201443 PRK05201, hslU, ATP-dependent protease ATP-binding 4e-14
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 7e-14
PRK05201443 PRK05201, hslU, ATP-dependent protease ATP-binding 2e-13
pfam1043181 pfam10431, ClpB_D2-small, C-terminal, D2-small dom 2e-10
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-09
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 1e-08
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 2e-08
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-06
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 4e-06
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 4e-06
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 5e-06
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 3e-05
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-05
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 4e-05
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 4e-05
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 6e-05
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 7e-05
COG0542 786 COG0542, clpA, ATP-binding subunits of Clp proteas 3e-04
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 3e-04
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-04
CHL00176638 CHL00176, ftsH, cell division protein; Validated 7e-04
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 7e-04
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 0.001
pfam13481154 pfam13481, AAA_25, AAA domain 0.001
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 0.002
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 0.003
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.003
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 0.004
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information 
 Score =  549 bits (1417), Expect = 0.0
 Identities = 209/395 (52%), Positives = 266/395 (67%), Gaps = 55/395 (13%)

Query: 71  DLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKE 130
           +LPTPKEI   LD++VIGQERAKK         + V       AVYNHYKR+ H      
Sbjct: 58  ELPTPKEIKAHLDQYVIGQERAKKV--------LSV-------AVYNHYKRLRHGD---- 98

Query: 131 LVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVP 190
                                  + D+ VEL+KSN+LL+GPTGSGKTLLA+TLARI++VP
Sbjct: 99  -----------------------KKDDDVELQKSNILLIGPTGSGKTLLAQTLARILDVP 135

Query: 191 FTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIV-KAESRNNG 249
           F I DAT LT+AGYVGED E++L KLL AAD+DVE AQRGIVYIDE+DKI  K+E+ +  
Sbjct: 136 FAIADATTLTEAGYVGEDVENILLKLLQAADYDVEKAQRGIVYIDEIDKIARKSENPSIT 195

Query: 250 RDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKT 309
           RDVSGEGVQQALLK+LEGTV +V  P  G RKHP+ + I +DT +ILFICGGAF GLEK 
Sbjct: 196 RDVSGEGVQQALLKILEGTVASV--PPQGGRKHPQQEFIQVDTTNILFICGGAFDGLEKI 253

Query: 310 ISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILV 369
           I +R     IGFGA V++        +      LL+ V+  DL+ +GLIPEFIGR P++ 
Sbjct: 254 IKQRLGKKGIGFGAEVKSK------KEKRTEGELLKQVEPEDLIKFGLIPEFIGRLPVVA 307

Query: 370 SLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGL 429
           +L  L+E+ LV++L EPKNAL +QY+K+F M+ V+L FTD+AL  IAKKA+ + TGARGL
Sbjct: 308 TLEELDEEALVRILTEPKNALVKQYQKLFEMDGVELEFTDEALEAIAKKAIERKTGARGL 367

Query: 430 RALLENILTEAMFEIPETKIGTSSVNAVLVDKEAV 464
           R++LE IL + MFE+P  +     V  V++ KE V
Sbjct: 368 RSILEEILLDVMFELPSRE----DVEKVVITKEVV 398

Length = 412
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|198154 smart01086, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|204486 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 510
KOG0745564 consensus Putative ATP-dependent Clp-type protease 100.0
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 100.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 100.0
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 100.0
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 100.0
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 100.0
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.97
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.97
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.96
PRK10865857 protein disaggregation chaperone; Provisional 99.96
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 99.94
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.91
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.9
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.9
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.89
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.88
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.88
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.87
CHL00181287 cbbX CbbX; Provisional 99.87
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.87
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.86
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.85
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.82
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.81
COG2204464 AtoC Response regulator containing CheY-like recei 99.81
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.8
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.8
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.79
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.78
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.78
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.78
CHL00195489 ycf46 Ycf46; Provisional 99.77
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.75
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.75
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.74
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.74
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.73
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.73
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.72
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.72
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.72
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.71
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.7
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.69
PRK11608326 pspF phage shock protein operon transcriptional ac 99.69
PRK03992389 proteasome-activating nucleotidase; Provisional 99.69
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.68
CHL00176 638 ftsH cell division protein; Validated 99.68
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.68
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.67
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.66
COG1221403 PspF Transcriptional regulators containing an AAA- 99.66
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.65
PRK15424538 propionate catabolism operon regulatory protein Pr 99.65
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.64
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.64
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.64
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.63
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.63
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.62
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.61
KOG2028 554 consensus ATPase related to the helicase subunit o 99.61
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.61
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.61
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.6
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.6
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.59
CHL00206 2281 ycf2 Ycf2; Provisional 99.59
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.58
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.58
PF00004132 AAA: ATPase family associated with various cellula 99.58
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.57
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.57
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.57
PRK13342 413 recombination factor protein RarA; Reviewed 99.56
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.56
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.55
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.55
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.55
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.55
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.54
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.53
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.53
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.53
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.53
PLN03025319 replication factor C subunit; Provisional 99.53
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.53
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.53
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.53
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.52
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.52
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.51
PRK13341 725 recombination factor protein RarA/unknown domain f 99.51
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.51
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.51
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.5
COG0714329 MoxR-like ATPases [General function prediction onl 99.5
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.5
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.49
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.49
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.49
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.48
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.47
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.47
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.47
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.47
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.47
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.47
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.47
smart00350509 MCM minichromosome maintenance proteins. 99.45
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.45
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.45
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK15115444 response regulator GlrR; Provisional 99.45
PRK13531 498 regulatory ATPase RavA; Provisional 99.44
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.44
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.44
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.43
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.42
PHA02244383 ATPase-like protein 99.41
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.41
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK12402337 replication factor C small subunit 2; Reviewed 99.4
PRK05642234 DNA replication initiation factor; Validated 99.39
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.39
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.39
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.39
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.39
PHA02544316 44 clamp loader, small subunit; Provisional 99.38
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK08084235 DNA replication initiation factor; Provisional 99.38
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK04195 482 replication factor C large subunit; Provisional 99.37
PRK06893229 DNA replication initiation factor; Validated 99.37
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.36
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.36
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.36
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.35
CHL00095 821 clpC Clp protease ATP binding subunit 99.35
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.35
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.35
PRK10865 857 protein disaggregation chaperone; Provisional 99.34
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.34
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK09862506 putative ATP-dependent protease; Provisional 99.34
PRK07940394 DNA polymerase III subunit delta'; Validated 99.34
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.34
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.33
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.33
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.33
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.33
PTZ00111915 DNA replication licensing factor MCM4; Provisional 99.33
PRK00149450 dnaA chromosomal replication initiation protein; R 99.33
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.31
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.31
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.31
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.31
PRK08727233 hypothetical protein; Validated 99.31
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.3
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.3
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.29
PF07726131 AAA_3: ATPase family associated with various cellu 99.29
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.29
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.29
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.28
PRK00440319 rfc replication factor C small subunit; Reviewed 99.28
PRK14086617 dnaA chromosomal replication initiation protein; P 99.27
PRK12422445 chromosomal replication initiation protein; Provis 99.26
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.25
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.24
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.23
PRK14088440 dnaA chromosomal replication initiation protein; P 99.2
PRK14087450 dnaA chromosomal replication initiation protein; P 99.19
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.19
PRK09112351 DNA polymerase III subunit delta'; Validated 99.19
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.19
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.14
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.11
PRK13765 637 ATP-dependent protease Lon; Provisional 99.11
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.1
PRK06620214 hypothetical protein; Validated 99.08
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 99.08
PRK07471365 DNA polymerase III subunit delta'; Validated 99.07
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.05
PRK04132846 replication factor C small subunit; Provisional 99.05
PRK09087226 hypothetical protein; Validated 99.04
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.03
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.02
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.02
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.01
COG1241682 MCM2 Predicted ATPase involved in replication cont 99.01
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.99
PRK07399314 DNA polymerase III subunit delta'; Validated 98.98
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.97
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.96
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.95
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.94
PRK08058329 DNA polymerase III subunit delta'; Validated 98.92
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.91
PRK05564313 DNA polymerase III subunit delta'; Validated 98.91
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 98.89
KOG0480764 consensus DNA replication licensing factor, MCM6 c 98.88
PRK05707328 DNA polymerase III subunit delta'; Validated 98.82
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.81
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.8
COG0593408 DnaA ATPase involved in DNA replication initiation 98.78
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.74
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.69
PRK06871325 DNA polymerase III subunit delta'; Validated 98.67
PRK07993334 DNA polymerase III subunit delta'; Validated 98.65
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.64
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.61
PRK06964342 DNA polymerase III subunit delta'; Validated 98.6
PF13173128 AAA_14: AAA domain 98.6
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 98.58
PRK08769319 DNA polymerase III subunit delta'; Validated 98.58
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.58
smart00382148 AAA ATPases associated with a variety of cellular 98.57
PRK08116268 hypothetical protein; Validated 98.5
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.5
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.47
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.47
PRK12377248 putative replication protein; Provisional 98.47
KOG0736 953 consensus Peroxisome assembly factor 2 containing 98.47
PRK06090319 DNA polymerase III subunit delta'; Validated 98.46
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.46
PRK08699325 DNA polymerase III subunit delta'; Validated 98.44
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 98.43
PRK08181269 transposase; Validated 98.41
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.36
PRK06526254 transposase; Provisional 98.35
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.32
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.3
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.3
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.26
KOG0477854 consensus DNA replication licensing factor, MCM2 c 98.22
KOG0481729 consensus DNA replication licensing factor, MCM5 c 98.19
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.19
PRK07952244 DNA replication protein DnaC; Validated 98.17
PRK05917290 DNA polymerase III subunit delta'; Validated 98.16
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.14
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.13
PRK09183259 transposase/IS protein; Provisional 98.11
PRK06835329 DNA replication protein DnaC; Validated 98.1
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.05
PRK08939306 primosomal protein DnaI; Reviewed 97.99
PRK06921266 hypothetical protein; Provisional 97.98
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 97.91
PRK07132299 DNA polymerase III subunit delta'; Validated 97.88
KOG0482721 consensus DNA replication licensing factor, MCM7 c 97.87
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.82
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 97.81
PRK05818261 DNA polymerase III subunit delta'; Validated 97.79
PRK07276290 DNA polymerase III subunit delta'; Validated 97.78
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.74
PF05729166 NACHT: NACHT domain 97.73
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.73
PRK00131175 aroK shikimate kinase; Reviewed 97.58
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.56
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.53
PRK08118167 topology modulation protein; Reviewed 97.49
PRK13947171 shikimate kinase; Provisional 97.47
PHA00729226 NTP-binding motif containing protein 97.46
PF10923416 DUF2791: P-loop Domain of unknown function (DUF279 97.45
PRK00625173 shikimate kinase; Provisional 97.44
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.43
PRK07261171 topology modulation protein; Provisional 97.42
PRK03839180 putative kinase; Provisional 97.4
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.37
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.37
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.37
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.35
cd01128249 rho_factor Transcription termination factor rho is 97.32
PRK13948182 shikimate kinase; Provisional 97.3
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.3
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.3
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.28
PRK06217183 hypothetical protein; Validated 97.27
PRK13949169 shikimate kinase; Provisional 97.25
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 97.24
PRK14532188 adenylate kinase; Provisional 97.22
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.21
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.2
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.19
PRK14530215 adenylate kinase; Provisional 97.19
PHA02774613 E1; Provisional 97.19
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.18
PRK13946184 shikimate kinase; Provisional 97.17
PRK06762166 hypothetical protein; Provisional 97.15
PRK09376416 rho transcription termination factor Rho; Provisio 97.15
PRK14531183 adenylate kinase; Provisional 97.14
PRK15455 644 PrkA family serine protein kinase; Provisional 97.14
PRK03731171 aroL shikimate kinase II; Reviewed 97.12
PRK05480209 uridine/cytidine kinase; Provisional 97.12
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.11
PRK05057172 aroK shikimate kinase I; Reviewed 97.11
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 97.1
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.09
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.08
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.07
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.06
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.05
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.03
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.03
PTZ00088229 adenylate kinase 1; Provisional 97.02
TIGR00767415 rho transcription termination factor Rho. Members 97.02
PRK14974336 cell division protein FtsY; Provisional 97.02
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.99
PRK10536262 hypothetical protein; Provisional 96.98
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 96.96
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.95
PRK08154309 anaerobic benzoate catabolism transcriptional regu 96.95
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.95
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.93
PHA02624647 large T antigen; Provisional 96.92
PRK06547172 hypothetical protein; Provisional 96.92
PRK14528186 adenylate kinase; Provisional 96.91
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.85
PRK04296190 thymidine kinase; Provisional 96.85
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.84
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.83
PTZ00301210 uridine kinase; Provisional 96.82
TIGR00235207 udk uridine kinase. Model contains a number of lon 96.81
PRK06067234 flagellar accessory protein FlaH; Validated 96.8
PRK02496184 adk adenylate kinase; Provisional 96.79
PF14516331 AAA_35: AAA-like domain 96.78
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.75
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.73
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.72
PRK00771437 signal recognition particle protein Srp54; Provisi 96.72
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.71
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.71
PLN02200234 adenylate kinase family protein 96.7
PLN02199303 shikimate kinase 96.7
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 96.69
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.69
PRK00279215 adk adenylate kinase; Reviewed 96.66
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 96.66
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.65
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.58
PRK04040188 adenylate kinase; Provisional 96.57
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.57
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.56
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.56
PRK14527191 adenylate kinase; Provisional 96.55
PF1324576 AAA_19: Part of AAA domain 96.53
PHA01747425 putative ATP-dependent protease 96.52
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 96.52
PRK04182180 cytidylate kinase; Provisional 96.51
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 96.5
PLN02674244 adenylate kinase 96.48
PRK06696223 uridine kinase; Validated 96.41
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 96.4
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 96.39
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.38
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.38
PRK14526211 adenylate kinase; Provisional 96.37
PRK05541176 adenylylsulfate kinase; Provisional 96.37
PRK08233182 hypothetical protein; Provisional 96.36
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 96.36
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 96.36
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.36
cd03115173 SRP The signal recognition particle (SRP) mediates 96.35
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 96.34
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 96.34
PHA02530300 pseT polynucleotide kinase; Provisional 96.34
PRK01184184 hypothetical protein; Provisional 96.31
PLN02165334 adenylate isopentenyltransferase 96.3
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.3
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.29
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 96.29
PRK04220301 2-phosphoglycerate kinase; Provisional 96.28
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.28
COG4178604 ABC-type uncharacterized transport system, permeas 96.27
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.22
PRK12608380 transcription termination factor Rho; Provisional 96.22
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.22
PRK00889175 adenylylsulfate kinase; Provisional 96.22
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.22
PRK14529223 adenylate kinase; Provisional 96.2
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 96.2
PLN02459261 probable adenylate kinase 96.2
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 96.19
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 96.18
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.14
PRK03846198 adenylylsulfate kinase; Provisional 96.13
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.11
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.09
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.07
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.06
PRK11823446 DNA repair protein RadA; Provisional 96.04
PLN02318 656 phosphoribulokinase/uridine kinase 96.04
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 96.04
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 96.03
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 96.03
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 96.02
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.02
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 95.92
PF13479213 AAA_24: AAA domain 95.91
PRK13808333 adenylate kinase; Provisional 95.89
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.88
PRK12339197 2-phosphoglycerate kinase; Provisional 95.86
COG1485367 Predicted ATPase [General function prediction only 95.86
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 95.84
PRK10867433 signal recognition particle protein; Provisional 95.83
PRK09825176 idnK D-gluconate kinase; Provisional 95.81
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 95.78
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 95.77
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.77
TIGR00064272 ftsY signal recognition particle-docking protein F 95.76
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 95.74
PRK13764602 ATPase; Provisional 95.73
PRK09354349 recA recombinase A; Provisional 95.73
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.73
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.73
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 95.71
PRK10416318 signal recognition particle-docking protein FtsY; 95.71
cd00983325 recA RecA is a bacterial enzyme which has roles in 95.7
PRK06581263 DNA polymerase III subunit delta'; Validated 95.69
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.68
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 95.68
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 95.67
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.67
cd01394218 radB RadB. The archaeal protein radB shares simila 95.65
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.65
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.65
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 95.64
PLN02840421 tRNA dimethylallyltransferase 95.64
PRK08356195 hypothetical protein; Provisional 95.62
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.61
PRK00300205 gmk guanylate kinase; Provisional 95.6
PRK14730195 coaE dephospho-CoA kinase; Provisional 95.6
PRK07667193 uridine kinase; Provisional 95.59
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.59
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 95.58
PRK11545163 gntK gluconate kinase 1; Provisional 95.57
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 95.57
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 95.56
PRK12338319 hypothetical protein; Provisional 95.55
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.55
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.54
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.53
PRK14737186 gmk guanylate kinase; Provisional 95.5
PLN02796347 D-glycerate 3-kinase 95.49
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 95.49
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 95.48
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 95.47
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 95.46
PRK13975196 thymidylate kinase; Provisional 95.41
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.38
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 95.37
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 95.36
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.35
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 95.35
cd01393226 recA_like RecA is a bacterial enzyme which has rol 95.34
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 95.33
COG3842352 PotA ABC-type spermidine/putrescine transport syst 95.32
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 95.32
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 95.29
PRK04841 903 transcriptional regulator MalT; Provisional 95.29
PRK14700 300 recombination factor protein RarA; Provisional 95.27
PRK00081194 coaE dephospho-CoA kinase; Reviewed 95.27
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.26
PRK00023225 cmk cytidylate kinase; Provisional 95.25
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.25
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 95.23
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 95.23
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 95.23
TIGR00959428 ffh signal recognition particle protein. This mode 95.18
PLN02348395 phosphoribulokinase 95.16
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 95.15
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 95.14
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 95.12
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.12
PRK14733204 coaE dephospho-CoA kinase; Provisional 95.1
PRK06761282 hypothetical protein; Provisional 95.07
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.06
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.04
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.04
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 95.02
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.0
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 95.0
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.97
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.96
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.96
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.94
TIGR02533486 type_II_gspE general secretory pathway protein E. 94.92
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 94.91
PRK10436462 hypothetical protein; Provisional 94.89
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 94.89
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7.9e-78  Score=608.05  Aligned_cols=453  Identities=57%  Similarity=0.867  Sum_probs=387.8

Q ss_pred             CCCCcccccccccc---cCCCCccchhhhhhccchhhcccCCcccCCCCCCCCCCccccccCCCCCCCCCCCCCCChHHH
Q 038067            2 VNFCPKCKTAFYFR---PFKLTPLEGSFIELGKVKVEEIMGGFIRKDGESNGIESESETENGNRNRNSEGNIDLPTPKEI   78 (510)
Q Consensus         2 ~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~el   78 (510)
                      .++|..|.....|.   +|...+.+.+|..++++...                ..+-.....|  .|-.-.+.+|+|++|
T Consensus        78 ~~~~s~~~~~~t~~~s~~f~~~k~~~sfv~~~~~~~~----------------~~~~~~p~~~--~gg~~~k~~P~PkeI  139 (564)
T KOG0745|consen   78 PKCTSQCTPLETFVSSQGFILCKCNKSFVVLYEADGA----------------KPGKLSPSNR--DGGFQLKPPPTPKEI  139 (564)
T ss_pred             ccccccCCchhhccCCCCeEEeeccchhhhhhhcccC----------------CCCCCCcccc--ccccccCCCCChHHH
Confidence            45677788888888   57777889999998882221                1111112233  222333378999999


Q ss_pred             HhhhccccccchhhhhccchhhhhhhhhhhhhHHHHHHHHHHHHhhhh--hhhhhhc--------ccccccccccCCccC
Q 038067           79 CKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSS--LQKELVS--------DHLYVDSILGSGVKS  148 (510)
Q Consensus        79 ~~~L~~~ViGQ~~ak~~~~~~~~~~~~~~~~~l~~av~~~~~r~~~~~--~~~~~~~--------~~~~~~~~~~~~~~~  148 (510)
                      +++||+|||||+.||++               |++||||||+|++++.  ..++...        +.+...++......+
T Consensus       140 ~~~Ldk~VVGQe~AKKv---------------LsVAVYnHYkRI~hn~~s~~~~~a~~s~~~~~~~~P~~~~~~~~~a~~  204 (564)
T KOG0745|consen  140 CEYLDKFVVGQEKAKKV---------------LSVAVYNHYKRIYHNEPSRQKELAEASKSAKDRDNPIELEISESNAQW  204 (564)
T ss_pred             HHHhhhheechhhhhhe---------------eeehhhHHHHHHhcchHHHHHHHhhhhhcccCCCCccccccccccccc
Confidence            99999999999999999               9999999999999942  2222110        011111111111112


Q ss_pred             ------CCCCCCcc-hhhhccCceEEEEccCCChHHHHHHHHHHHhCCCeEEEeccccccccccccchhhHHHHHHHhhc
Q 038067          149 ------GNCNVEND-EIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAAD  221 (510)
Q Consensus       149 ------g~~~~~~~-~~~~~~~~~vLL~GPpGtGKT~lAr~lA~~l~~p~~~~~~s~l~~~gy~G~~~~~~l~~l~~~~~  221 (510)
                            ++...+++ +++++.++|+||.||+|+|||+||+.||+.+++||..+||++++++||+|++++..+.+++..+.
T Consensus       205 ~~~~r~~~~~ld~~~~dv~LeKSNvLllGPtGsGKTllaqTLAr~ldVPfaIcDcTtLTQAGYVGeDVEsvi~KLl~~A~  284 (564)
T KOG0745|consen  205 PNNQRQIAKALDEDDEDVELEKSNVLLLGPTGSGKTLLAQTLARVLDVPFAICDCTTLTQAGYVGEDVESVIQKLLQEAE  284 (564)
T ss_pred             ccccchhcccccccccceeeecccEEEECCCCCchhHHHHHHHHHhCCCeEEecccchhhcccccccHHHHHHHHHHHcc
Confidence                  33333333 58999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHhcCcEEEEcchhhhh-hhccCCCCCCCchhhHHHHHHHHhhCceeeeccCCCCCCCCCCCCcEEEEcCCceeecC
Q 038067          222 FDVEAAQRGIVYIDEVDKIV-KAESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICG  300 (510)
Q Consensus       222 ~~~~~~~~~Vl~iDEidkl~-~~~~~~~~~~~~~~~v~~~LL~~leg~~~~i~~~~~g~~~~~~~~~i~i~tsnilfI~t  300 (510)
                      +++++++.||+||||+||+. ++++.+..||+++++||++||+++||+.+.+|  ..|.++.++++.+.|||+|++|||+
T Consensus       285 ~nVekAQqGIVflDEvDKi~~~~~~i~~~RDVsGEGVQQaLLKllEGtvVnVp--eK~~~~~~rgd~vqiDTtnILFias  362 (564)
T KOG0745|consen  285 YNVEKAQQGIVFLDEVDKITKKAESIHTSRDVSGEGVQQALLKLLEGTVVNVP--EKGSRRKPRGDTVQIDTTNILFIAS  362 (564)
T ss_pred             CCHHHHhcCeEEEehhhhhcccCccccccccccchhHHHHHHHHhcccEEccc--CCCCCCCCCCCeEEEeccceEEEec
Confidence            99999999999999999999 66677788999999999999999999999998  8999999999999999999999999


Q ss_pred             CCccchHHHHHhhcccCCCCcCcc----ccccccc-CCCchh-hhhhhhhhccCchhhhhcCCchhhhcccCceEecCCC
Q 038067          301 GAFVGLEKTISERRQDSSIGFGAP----VRANMRT-GGLTDA-LVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSAL  374 (510)
Q Consensus       301 g~~~~l~~~i~~~~~~~~~gf~~~----~~~~~~~-~~~~~~-~~~~~~l~~~~~~dl~~~~~~Pefl~R~~~iv~f~~L  374 (510)
                      |+|.+|++++.+|+.+.++||+.+    .+.++.+ +..... .....+++.+++.||+.+|++|||++||+++|+|.+|
T Consensus       363 GAF~~Ldk~I~rR~~d~slGFg~~s~~~vr~~~~~~s~~~~~~~~~~~lL~~~~~~DLisfGmIPEfVGRfPVlVplh~L  442 (564)
T KOG0745|consen  363 GAFVGLDKIISRRLDDKSLGFGAPSSKGVRANMATKSGVENDAEKRDELLEKVESGDLISFGMIPEFVGRFPVLVPLHSL  442 (564)
T ss_pred             ccccchHHHHHHhhcchhcccCCCCCccchhhcccccCcchhHHHHHHHHhhccccchhhhcCcHHHhcccceEeecccc
Confidence            999999999999999999999998    6667666 333333 3455699999999999999999999999999999999


Q ss_pred             CHHHHHHHHhchhHHHHHHHHHHHhcCCceeeeCHHHHHHHHHhhCCCCCChhHHHHHHHHHHHHHHhcCcCCCCCCCcc
Q 038067          375 NEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSV  454 (510)
Q Consensus       375 s~eel~~Il~~~~~~l~~~~~~~~~~~~~~l~is~~al~~La~~~~~~~~gaR~L~~~ie~~l~~~l~~~~~~~~~~~~i  454 (510)
                      ++++|.+|++++.|++++||+.+|.+.+++|+||++|++.||+.++..++|||+||.++|++|+++||+.|+.     .|
T Consensus       443 ~~~~Lv~VLtEPknaL~~Qyk~lf~~~nV~L~fTe~Al~~IAq~Al~r~TGARgLRsIlE~~LleamfevPGS-----dI  517 (564)
T KOG0745|consen  443 DEDQLVRVLTEPKNALGKQYKKLFGMDNVELHFTEKALEAIAQLALKRKTGARGLRSILESLLLEAMFEVPGS-----DI  517 (564)
T ss_pred             CHHHHHHHHhcchhhHHHHHHHHhccCCeeEEecHHHHHHHHHHHHhhccchHHHHHHHHHHHhhhcccCCCC-----ce
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999965     49


Q ss_pred             cEEEEccccccCcCCCCcceeEecCCchHHHHHHhhhccc
Q 038067          455 NAVLVDKEAVGSVDAPGCGAKILHGDGELERVLHETKSAH  494 (510)
Q Consensus       455 ~~~~v~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  494 (510)
                      ..|+||++.|.+...++|.++++.|++.+++++.+.+.+.
T Consensus       518 ~~V~Vdee~v~g~~~~~~s~~~~~~~~~~~~~~se~~~~~  557 (564)
T KOG0745|consen  518 KAVLVDEEAVKGEKEPGYSRKILKGDEVLERYVSETESKD  557 (564)
T ss_pred             EEEEecHHHhcccCCCccchhhhcccchhhhhcccccccc
Confidence            9999999999999999999999999999999998877665

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
3hte_A363 Crystal Structure Of Nucleotide-Free Hexameric Clpx 1e-96
3hws_A363 Crystal Structure Of Nucleotide-Bound Hexameric Clp 1e-96
1um8_A376 Crystal Structure Of Helicobacter Pylori Clpx Lengt 1e-87
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 7e-36
1g3i_A444 Crystal Structure Of The Hsluv Protease-Chaperone C 4e-18
1im2_A444 Hslu, Haemophilus Influenzae, Selenomethionine Vari 2e-17
1do2_A442 Trigonal Crystal Form Of Heat Shock Locus U (Hslu) 3e-17
1e94_E449 Hslv-Hslu From E.Coli Length = 449 3e-17
1g4a_E443 Crystal Structures Of The Hslvu Peptidase-Atpase Co 4e-17
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 2e-06
3vfd_A389 Human Spastin Aaa Domain Length = 389 1e-05
3b9p_A297 Spastin Length = 297 5e-05
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 6e-05
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 6e-05
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 1e-04
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 2e-04
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-04
2ce7_A476 Edta Treated Length = 476 3e-04
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 4e-04
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 4e-04
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 4e-04
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 6e-04
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 6e-04
>pdb|3HTE|A Chain A, Crystal Structure Of Nucleotide-Free Hexameric Clpx Length = 363 Back     alignment and structure 
Iteration: 1

 Score =  350 bits (898), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 195/401 (48%), Positives = 259/401 (64%), Gaps = 57/401 (14%)
Query: 72  LPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKEL 131
           LPTP EI   LD++VIGQE+AKK                   AVYNHYKR+         
Sbjct: 3   LPTPHEIRNHLDDYVIGQEQAKKV---------------LAVAVYNHYKRLR-------- 39
Query: 132 VSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPF 191
                             N +  N   VEL KSN+LL+GPTGSGKTLLA+TLAR+++VPF
Sbjct: 40  ------------------NGDTSNG--VELGKSNILLIGPTGSGKTLLAETLARLLDVPF 79
Query: 192 TITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIV-KAESRNNGR 250
           T+ DAT LT+AGYVGED E+++ KLL   D+DV+ AQRGIVYID++DKI  K+++ +  R
Sbjct: 80  TMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVYIDQIDKISRKSDNPSITR 139
Query: 251 DVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKTI 310
           DVSGEGVQQALLK++EGTV  VP P  G RKHP+ + + +DT  ILFICGGAF GL+K I
Sbjct: 140 DVSGEGVQQALLKLIEGTVAAVP-PQGG-RKHPQQEFLQVDTSKILFICGGAFAGLDKVI 197
Query: 311 SERRQD-SSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILV 369
           S R +  S IGFGA V+A       +D      LL  V+  DL+ +GLIPEFIGR P++ 
Sbjct: 198 SHRVETGSGIGFGATVKAK------SDKASEGELLAQVEPEDLIKFGLIPEFIGRLPVVA 251
Query: 370 SLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGL 429
           +L+ L+E+ L+Q+L EPKNAL +QY+ +F++  V L F D+AL  IAKKAMA+ TGARGL
Sbjct: 252 TLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAIAKKAMARKTGARGL 311
Query: 430 RALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAP 470
           R+++E  L + M+++P  +     V  V++D+  +     P
Sbjct: 312 RSIVEAALLDTMYDLPSME----DVEKVVIDESVIDGQSKP 348
>pdb|3HWS|A Chain A, Crystal Structure Of Nucleotide-Bound Hexameric Clpx Length = 363 Back     alignment and structure
>pdb|1UM8|A Chain A, Crystal Structure Of Helicobacter Pylori Clpx Length = 376 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|1G3I|A Chain A, Crystal Structure Of The Hsluv Protease-Chaperone Complex Length = 444 Back     alignment and structure
>pdb|1IM2|A Chain A, Hslu, Haemophilus Influenzae, Selenomethionine Variant Length = 444 Back     alignment and structure
>pdb|1DO2|A Chain A, Trigonal Crystal Form Of Heat Shock Locus U (Hslu) From Escherichia Coli Length = 442 Back     alignment and structure
>pdb|1E94|E Chain E, Hslv-Hslu From E.Coli Length = 449 Back     alignment and structure
>pdb|1G4A|E Chain E, Crystal Structures Of The Hslvu Peptidase-Atpase Complex Reveal An Atp-Dependent Proteolysis Mechanism Length = 443 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 0.0
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 0.0
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 1e-99
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 2e-33
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 7e-10
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-09
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-05
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 4e-08
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 2e-07
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-06
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 9e-06
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-05
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-05
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 4e-05
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 4e-05
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 7e-05
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 1e-04
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-04
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 3e-04
2r62_A268 Cell division protease FTSH homolog; ATPase domain 4e-04
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 4e-04
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 5e-04
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 5e-04
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 5e-04
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 5e-04
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-04
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-04
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Length = 376 Back     alignment and structure
 Score =  521 bits (1343), Expect = 0.0
 Identities = 178/401 (44%), Positives = 256/401 (63%), Gaps = 45/401 (11%)

Query: 71  DLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKE 130
            +P PKE+   LD +VIGQE+AKK           V       AVYNHYKR+        
Sbjct: 8   YIPAPKELKAVLDNYVIGQEQAKKV--------FSV-------AVYNHYKRLSFK----- 47

Query: 131 LVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVP 190
                   + +     +  N  +E+ E VEL KSN+LL+GPTGSGKTL+A+TLA+ +++P
Sbjct: 48  --------EKLKKQDNQDSNVELEHLEEVELSKSNILLIGPTGSGKTLMAQTLAKHLDIP 99

Query: 191 FTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKIV-KAESRNNG 249
             I+DAT+LT+AGYVGED E++L +LL A+D++V+ AQ+GIV+IDE+DKI   +E+R+  
Sbjct: 100 IAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQKGIVFIDEIDKISRLSENRSIT 159

Query: 250 RDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKT 309
           RDVSGEGVQQALLK++EG++VN+P P  G RKHP G+ I IDT DILFIC GAF GL + 
Sbjct: 160 RDVSGEGVQQALLKIVEGSLVNIP-PKGG-RKHPEGNFIQIDTSDILFICAGAFDGLAEI 217

Query: 310 ISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILV 369
           I +R   + +GF     +              ++L  V + DLV YGLIPE IGR P+L 
Sbjct: 218 IKKRTTQNVLGFTQEKMSKKE---------QEAILHLVQTHDLVTYGLIPELIGRLPVLS 268

Query: 370 SLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGL 429
           +L +++ + +V +L +PKNAL +QY+++F M+ V L F ++A++ IA+ A+ + TGARGL
Sbjct: 269 TLDSISLEAMVDILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEIAQLALERKTGARGL 328

Query: 430 RALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVDAP 470
           RA++E+   + MF++P+ K        V + K+ V     P
Sbjct: 329 RAIIEDFCLDIMFDLPKLKGSE-----VRITKDCVLKQAEP 364
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Length = 363 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Length = 444 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Length = 444 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} PDB: 2axp_A* Length = 173 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 100.0
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 100.0
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 100.0
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.96
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.95
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.94
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.93
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.93
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.87
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.85
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.85
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.85
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.84
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.84
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.84
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.84
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.82
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.81
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.81
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.8
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.79
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.78
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.76
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.76
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.76
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.75
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.75
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.74
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.72
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.72
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.71
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.71
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.71
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.7
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.7
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.69
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.69
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.69
3pvs_A 447 Replication-associated recombination protein A; ma 99.68
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.67
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.67
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.67
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.63
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.61
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.6
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.59
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.59
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.58
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.58
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.56
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.55
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.55
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.55
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.54
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.53
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.53
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.52
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.51
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.5
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.49
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.49
3co5_A143 Putative two-component system transcriptional RES 99.49
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.48
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.48
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.48
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.48
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.47
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.47
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.45
3bos_A242 Putative DNA replication factor; P-loop containing 99.43
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.41
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.41
3f8t_A506 Predicted ATPase involved in replication control, 99.4
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.38
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.37
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.37
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.36
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.35
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.34
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.34
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.31
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.29
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.27
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.25
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.21
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.98
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.73
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.66
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.54
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.42
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.32
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.29
2fna_A357 Conserved hypothetical protein; structural genomic 98.27
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.24
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.22
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.17
1tue_A212 Replication protein E1; helicase, replication, E1E 98.04
2qgz_A308 Helicase loader, putative primosome component; str 97.94
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.85
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.76
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 97.74
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.53
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.53
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.45
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.4
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.33
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.33
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.29
1via_A175 Shikimate kinase; structural genomics, transferase 97.27
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 97.26
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.25
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.22
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.2
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.18
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.15
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.12
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.11
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.1
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.09
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.08
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.07
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.07
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.05
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.05
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.05
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.05
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.04
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.02
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.0
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.99
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.99
1qzm_A94 ATP-dependent protease LA; oligomerization domain, 96.98
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.96
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.96
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.96
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.95
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.95
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.93
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.9
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.9
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.9
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.9
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.86
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.86
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.86
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.85
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.85
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.84
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.84
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.83
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.82
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.81
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.81
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.8
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.74
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.73
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.72
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.69
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.66
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.65
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.65
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.63
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.62
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.61
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.61
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.59
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.58
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.58
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.54
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.49
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.48
2z43_A324 DNA repair and recombination protein RADA; archaea 96.48
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.48
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.48
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.47
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.45
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.44
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.42
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.41
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.38
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.36
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.36
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.36
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.34
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.27
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.26
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.26
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.26
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.25
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.25
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.22
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 96.21
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.2
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.18
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.16
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.14
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.12
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.07
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.03
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.03
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.02
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.0
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.97
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.91
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.91
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.91
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.91
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 95.83
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.82
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 95.81
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.81
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.8
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.8
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.79
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.79
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.77
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.75
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.67
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.66
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.58
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.57
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.55
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.53
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.52
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.51
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.49
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.48
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.42
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.39
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.33
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.31
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.29
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.24
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.16
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.11
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.07
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.04
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.03
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 94.98
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.94
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.85
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.82
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.81
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 94.8
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.79
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.77
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.75
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.68
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.59
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.57
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 94.55
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.52
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 94.49
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.44
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.43
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 94.39
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.36
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 94.34
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.32
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 94.3
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.23
2xxa_A433 Signal recognition particle protein; protein trans 94.16
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 94.14
3kta_A182 Chromosome segregation protein SMC; structural mai 94.06
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.06
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.01
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 94.0
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.99
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.89
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.88
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.87
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.85
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.84
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.83
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 93.77
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 93.76
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.69
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 93.66
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.6
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 93.55
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 93.44
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.41
3ice_A422 Transcription termination factor RHO; transcriptio 93.38
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 93.36
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.34
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 93.32
2og2_A359 Putative signal recognition particle receptor; nuc 93.28
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 93.24
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 93.24
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 93.23
1p9r_A418 General secretion pathway protein E; bacterial typ 93.13
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.09
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.06
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.04
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.0
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 92.96
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.94
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 92.9
3io5_A333 Recombination and repair protein; storage dimer, i 92.9
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.89
1b0u_A262 Histidine permease; ABC transporter, transport pro 92.8
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.78
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 92.76
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.74
1g6h_A257 High-affinity branched-chain amino acid transport 92.67
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 92.66
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 92.65
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.64
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.64
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.63
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.62
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.6
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.6
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.59
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.58
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.56
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 92.49
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.49
1nrj_B218 SR-beta, signal recognition particle receptor beta 92.47
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 92.46
2ghi_A260 Transport protein; multidrug resistance protein, M 92.45
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.43
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.43
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.4
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.39
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.37
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 92.36
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 92.35
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 92.24
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 92.24
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.24
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 92.24
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 92.23
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 92.22
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.21
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 92.19
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.17
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 92.17
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 92.14
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.14
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 92.12
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 92.11
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.09
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 92.08
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.04
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.01
2ged_A193 SR-beta, signal recognition particle receptor beta 91.97
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 91.97
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.77
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 91.72
2wji_A165 Ferrous iron transport protein B homolog; membrane 91.7
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 91.68
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 91.68
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 91.67
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 91.64
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 91.61
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 91.58
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 91.56
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 91.5
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 91.48
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 91.48
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 91.44
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 91.41
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 91.34
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 91.33
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 91.32
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.32
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 91.31
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.3
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 91.25
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 91.23
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 91.23
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 91.17
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 91.16
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 91.16
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 91.15
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 91.1
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 91.08
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 91.06
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 91.05
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 91.05
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.0
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 90.94
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 90.94
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 90.93
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 90.92
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 90.87
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 90.83
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 90.81
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 90.78
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 90.77
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 90.75
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 90.68
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 90.65
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 90.64
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 90.63
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 90.62
2www_A349 Methylmalonic aciduria type A protein, mitochondri 90.62
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 90.59
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 90.58
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 90.51
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 90.49
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.49
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 90.48
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 90.46
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 90.44
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 90.43
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 90.41
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 90.39
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 90.38
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 90.38
3t1o_A198 Gliding protein MGLA; G domain containing protein, 90.33
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 90.3
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 90.29
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 90.17
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 90.13
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 90.11
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 90.02
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 90.0
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 89.99
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 89.97
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 89.94
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 89.93
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 89.93
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 89.88
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 89.88
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 89.83
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 89.82
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 89.79
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 89.79
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 89.74
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 89.73
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 89.73
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 89.68
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 89.67
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 89.61
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 89.6
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 89.6
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 89.57
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 89.57
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 89.49
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 89.48
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 89.46
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 89.42
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 89.42
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 89.38
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 89.36
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 89.29
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 89.22
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 89.19
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 89.17
3lxx_A239 GTPase IMAP family member 4; structural genomics c 89.15
2fh5_B214 SR-beta, signal recognition particle receptor beta 89.14
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 89.07
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 89.03
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 88.99
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 88.93
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 88.91
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 88.88
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 88.82
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 88.79
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 88.74
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 88.67
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 88.66
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 88.6
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 88.59
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 88.59
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 88.55
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 88.54
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 88.48
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 88.46
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 88.41
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 88.41
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 88.39
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 88.37
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 88.35
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 88.31
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 88.2
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 88.18
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 88.17
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 88.13
3b6e_A216 Interferon-induced helicase C domain-containing P; 88.11
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 88.04
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 87.97
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 87.97
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 87.96
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 87.91
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 87.74
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 87.71
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 87.7
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 87.61
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 87.53
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 87.45
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 87.4
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 87.36
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 87.28
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 87.24
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 87.18
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 87.16
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 87.13
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
Probab=100.00  E-value=1.5e-43  Score=367.18  Aligned_cols=346  Identities=55%  Similarity=0.921  Sum_probs=276.1

Q ss_pred             CCCChHHHHhhhccccccchhhhhccchhhhhhhhhhhhhHHHHHHHHHHHHhhhhhhhhhhcccccccccccCCccCCC
Q 038067           71 DLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKELVSDHLYVDSILGSGVKSGN  150 (510)
Q Consensus        71 ~~~~~~el~~~L~~~ViGQ~~ak~~~~~~~~~~~~~~~~~l~~av~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~g~  150 (510)
                      .+++|+++.+.|++.|+||+.+++.               +..++.+|+++......                       
T Consensus         2 ~~~~~~~l~~~l~~~i~G~~~~~~~---------------l~~~i~~~~~~~~~~~~-----------------------   43 (363)
T 3hws_A            2 ALPTPHEIRNHLDDYVIGQEQAKKV---------------LAVAVYNHYKRLRNGDT-----------------------   43 (363)
T ss_dssp             CCCCHHHHHHHHHHHCCSCHHHHHH---------------HHHHHHHHHHHHHTTSC-----------------------
T ss_pred             CCCCHHHHHHHHHhhccCHHHHHHH---------------HHHHHHHHHhhhccccc-----------------------
Confidence            4688999999999999999999999               99999989887654211                       


Q ss_pred             CCCCcchhhhccCceEEEEccCCChHHHHHHHHHHHhCCCeEEEeccccccccccccchhhHHHHHHHhhchhHHHhcCc
Q 038067          151 CNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRG  230 (510)
Q Consensus       151 ~~~~~~~~~~~~~~~vLL~GPpGtGKT~lAr~lA~~l~~p~~~~~~s~l~~~gy~G~~~~~~l~~l~~~~~~~~~~~~~~  230 (510)
                           ......++.++||+||||||||++|+++|+.++.||+.++++++...+|+|++..+.++.++..+.+.+..+.++
T Consensus        44 -----~~~~~~~~~~vll~GppGtGKT~la~~ia~~~~~~~~~~~~~~l~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~  118 (363)
T 3hws_A           44 -----SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRG  118 (363)
T ss_dssp             -----SSSCCCCCCCEEEECCTTSSHHHHHHHHHHHTTCCEEEEEHHHHTTCHHHHHHHTHHHHHHHHHTTTCHHHHHHC
T ss_pred             -----cccccCCCCeEEEECCCCCCHHHHHHHHHHHcCCCEEEechHHhcccccccccHHHHHHHHHHHhhhhHHhcCCc
Confidence                 011223668999999999999999999999999999999999998888999887888889988888777888899


Q ss_pred             EEEEcchhhhhhhcc-CCCCCCCchhhHHHHHHHHhhCceeeeccCCCCCCCCCCCCcEEEEcCCceeecCCCccchHHH
Q 038067          231 IVYIDEVDKIVKAES-RNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKT  309 (510)
Q Consensus       231 Vl~iDEidkl~~~~~-~~~~~~~~~~~v~~~LL~~leg~~~~i~~~~~g~~~~~~~~~i~i~tsnilfI~tg~~~~l~~~  309 (510)
                      ||||||||++...+. .+.+++.+++.+|+.||++|||..+.++  +.+++.....+.++|.|+|++||++|++.+++++
T Consensus       119 vl~lDEid~l~~~~~~~~~~~~~~~~~~~~~Ll~~leg~~~~~~--~~~~~~~~~~~~~~i~tsn~~~i~~g~~~~l~~~  196 (363)
T 3hws_A          119 IVYIDQIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAVP--PQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKV  196 (363)
T ss_dssp             EEEEECHHHHCCCSSCC---CHHHHHHHHHHHHHHHHCC------------------CCCCCTTSSEEEEEECCTTHHHH
T ss_pred             EEEEeChhhhcccccccccccccchHHHHHHHHHHhcCceeecc--CccccccCCCceEEEECCCceEEecCCcHHHHHH
Confidence            999999999986532 2334555666799999999998777766  7777777777888999999999999999999999


Q ss_pred             HHhhccc-CCCCcCcccccccccCCCchhhhhhhhhhccCchhhhhcCCchhhhcccCceEecCCCCHHHHHHHHhchhH
Q 038067          310 ISERRQD-SSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPKN  388 (510)
Q Consensus       310 i~~~~~~-~~~gf~~~~~~~~~~~~~~~~~~~~~~l~~~~~~dl~~~~~~Pefl~R~~~iv~f~~Ls~eel~~Il~~~~~  388 (510)
                      +.++..+ ..+||........      .......+.+.+.+.++.+.+|+|+|++||+.++.|.|++.+++.+|+..+++
T Consensus       197 i~~~~~~~~~~gf~~~~~~~~------~~~~~~~l~~~v~~~~l~~~~~~~~l~~R~~~~~~~~pl~~~~~~~I~~~~~~  270 (363)
T 3hws_A          197 ISHRVETGSGIGFGATVKAKS------DKASEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKN  270 (363)
T ss_dssp             HHHHHCCCC------------------CCSCHHHHHHTCCHHHHHHHTCCHHHHTTCCEEEECCCCCHHHHHHHHHSSTT
T ss_pred             HHHhhhccccCCccccccccc------cchhhHHHHHhCCHHHHHHcCCCHHHhcccCeeeecCCCCHHHHHHHHHHHHH
Confidence            9998876 7899977643321      11234577888999999999999999999999999999999999999998888


Q ss_pred             HHHHHHHHHHhcCCceeeeCHHHHHHHHHhhCCCCCChhHHHHHHHHHHHHHHhcCcCCCCCCCcccEEEEccccccCcC
Q 038067          389 ALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSVD  468 (510)
Q Consensus       389 ~l~~~~~~~~~~~~~~l~is~~al~~La~~~~~~~~gaR~L~~~ie~~l~~~l~~~~~~~~~~~~i~~~~v~~~~v~~~~  468 (510)
                      .+.++|.+.+...+..+.++++++++|++.+|.+++|+|+|+++|++.+.++++++|+..    .++.+.||++.+....
T Consensus       271 ~l~~~~~~~~~~~~~~l~~~~~a~~~L~~~~~~~~~gaR~L~~~ie~~~~~~l~~~~~~~----~~~~~~I~~~~v~~~~  346 (363)
T 3hws_A          271 ALTKQYQALFNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSME----DVEKVVIDESVIDGQS  346 (363)
T ss_dssp             CHHHHHHHHHHTTTCEEEECHHHHHHHHHHHHHTTCTTTTHHHHHHHHHHHHHHSTTTCC----CSEEEECHHHHTTCCS
T ss_pred             HHHHHHHHHHHhcCceEEECHHHHHHHHHhhcCCccCchHHHHHHHHHHHHHHHhccccc----CCceeEEcHHHHhCcC
Confidence            899999988888899999999999999999999999999999999999999999999774    4678999999998766


Q ss_pred             CCC
Q 038067          469 APG  471 (510)
Q Consensus       469 ~~~  471 (510)
                      .+-
T Consensus       347 ~~~  349 (363)
T 3hws_A          347 EPL  349 (363)
T ss_dssp             CCE
T ss_pred             Cce
Confidence            543
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 510
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 8e-93
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-74
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-54
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 1e-23
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 5e-21
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 3e-13
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 3e-11
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-10
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 1e-08
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 5e-08
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 2e-05
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 1e-04
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-04
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 2e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 2e-04
d1qvra2387 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus 2e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 5e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 6e-04
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 7e-04
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 8e-04
d2iyva1165 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycoba 0.001
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.001
d1viaa_161 c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact 0.001
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 0.004
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 0.004
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpX
species: Helicobacter pylori [TaxId: 210]

 Score =  285 bits (729), Expect = 8e-93
 Identities = 176/394 (44%), Positives = 254/394 (64%), Gaps = 40/394 (10%)

Query: 71  DLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKE 130
            +P PKE+   LD +VIGQE+AKK                   AVYNHYKR+      K+
Sbjct: 4   YIPAPKELKAVLDNYVIGQEQAKKV---------------FSVAVYNHYKRLSFKEKLKK 48

Query: 131 LVSDHLYVDSILGSGVKSGNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVP 190
             +    V+             +E+ E VEL KSN+LL+GPTGSGKTL+A+TLA+ +++P
Sbjct: 49  QDNQDSNVE-------------LEHLEEVELSKSNILLIGPTGSGKTLMAQTLAKHLDIP 95

Query: 191 FTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQRGIVYIDEVDKI-VKAESRNNG 249
             I+DAT+LT+AGYVGED E++L +LL A+D++V+ AQ+GIV+IDE+DKI   +E+R+  
Sbjct: 96  IAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQKGIVFIDEIDKISRLSENRSIT 155

Query: 250 RDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLEKT 309
           RDVSGEGVQQALLK++EG++VN+P    G RKHP G+ I IDT DILFIC GAF GL + 
Sbjct: 156 RDVSGEGVQQALLKIVEGSLVNIP--PKGGRKHPEGNFIQIDTSDILFICAGAFDGLAEI 213

Query: 310 ISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILV 369
           I +R   + +GF     +              ++L  V + DLV YGLIPE IGR P+L 
Sbjct: 214 IKKRTTQNVLGFTQEKMSKKEQ---------EAILHLVQTHDLVTYGLIPELIGRLPVLS 264

Query: 370 SLSALNEDQLVQVLMEPKNALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGL 429
           +L +++ + +V +L +PKNAL +QY+++F M+ V L F ++A++ IA+ A+ + TGARGL
Sbjct: 265 TLDSISLEAMVDILQKPKNALIKQYQQLFKMDEVDLIFEEEAIKEIAQLALERKTGARGL 324

Query: 430 RALLENILTEAMFEIPETKIGTSSVNAVLVDKEA 463
           RA++E+   + MF++P+ K     +    V K+A
Sbjct: 325 RAIIEDFCLDIMFDLPKLKGSEVRITKDCVLKQA 358
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 165 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 100.0
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.87
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.86
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.8
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.8
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.79
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.79
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.72
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.7
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.62
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.62
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.61
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.6
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.57
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.56
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.55
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.44
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.42
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.42
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.41
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.34
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.33
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.32
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.27
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.26
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.84
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.76
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.47
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.44
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.13
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.99
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.97
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.92
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.87
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.85
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.84
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.8
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.68
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.61
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.59
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.5
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.5
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.5
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.46
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.42
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.42
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.4
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.39
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.33
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.33
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.27
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.26
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.26
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.25
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.25
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.22
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.18
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 97.16
d1okkd2207 GTPase domain of the signal recognition particle r 97.13
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.11
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.07
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.03
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.98
d1vmaa2213 GTPase domain of the signal recognition particle r 96.92
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.92
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.9
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.89
d2qy9a2211 GTPase domain of the signal recognition particle r 96.86
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.77
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.76
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.74
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.43
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.3
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.21
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.17
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.1
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.0
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.74
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.54
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.44
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.4
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.33
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.29
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.13
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.05
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.02
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.86
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.8
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.77
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.76
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.74
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.65
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.51
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.29
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.25
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.24
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.21
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.02
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.95
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.92
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.79
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.76
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.63
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.55
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.54
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.46
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.29
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 93.22
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.12
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.09
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.09
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.07
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.01
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.93
d1g2912240 Maltose transport protein MalK, N-terminal domain 92.89
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.86
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.84
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.83
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.78
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.75
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.67
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.65
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.65
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.64
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.58
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.55
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.54
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.52
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.43
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.35
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.33
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.32
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 92.31
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.23
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.2
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.02
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.97
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.87
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.84
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.81
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.79
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.78
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 91.7
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.59
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 91.59
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 91.51
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.44
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.4
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.36
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.35
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 91.26
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.16
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.14
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.13
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.1
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.09
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.77
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.75
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.7
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.7
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.69
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.67
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.66
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.64
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.63
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.45
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.42
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 90.4
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.39
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 90.36
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.31
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.29
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 90.26
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.26
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.22
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.18
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.13
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.11
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 90.01
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.92
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.82
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.72
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 89.68
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.63
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.63
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.62
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 89.6
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.56
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.4
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.39
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.35
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.25
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.16
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.12
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.03
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 88.98
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 88.95
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 88.94
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.93
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 88.87
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.66
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.46
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.41
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 88.35
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 88.33
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 88.21
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 88.11
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 88.06
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 87.62
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 87.51
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 87.42
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 87.29
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 87.25
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.18
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 87.04
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 86.96
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 86.86
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 86.67
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 86.34
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 86.08
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.34
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 85.27
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 85.16
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.12
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 85.02
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 84.56
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 84.5
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 81.99
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.98
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 81.73
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 81.71
d1xpua3289 Transcription termination factor Rho, ATPase domai 80.63
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 80.5
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 80.09
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpX
species: Helicobacter pylori [TaxId: 210]

Probab=100.00  E-value=1.9e-55  Score=454.22  Aligned_cols=356  Identities=49%  Similarity=0.811  Sum_probs=280.5

Q ss_pred             CCCCChHHHHhhhccccccchhhhhccchhhhhhhhhhhhhHHHHHHHHHHHHhhhhhhhhh-hcccccccccccCCccC
Q 038067           70 IDLPTPKEICKGLDEFVIGQERAKKSHIFCILVDMLVYVIGACCAVYNHYKRIYHSSLQKEL-VSDHLYVDSILGSGVKS  148 (510)
Q Consensus        70 ~~~~~~~el~~~L~~~ViGQ~~ak~~~~~~~~~~~~~~~~~l~~av~~~~~r~~~~~~~~~~-~~~~~~~~~~~~~~~~~  148 (510)
                      ..+|+|++|+++|+++||||++||++               +++||+|||+|+......+.. .+...    +...    
T Consensus         3 ~~~~tP~ei~~~L~~~ViGQd~Akka---------------va~Avrn~~rR~~~~~~~r~~~~~~~~----~~~~----   59 (364)
T d1um8a_           3 SYIPAPKELKAVLDNYVIGQEQAKKV---------------FSVAVYNHYKRLSFKEKLKKQDNQDSN----VELE----   59 (364)
T ss_dssp             SCCCCHHHHHHHHHTTCCSCHHHHHH---------------HHHHHHHHHHHHHHHHHHHHHCSHHHH----HHHH----
T ss_pred             CCCCCHHHHHHHhCCeecChHHHHHH---------------HHHHHHHHHHHHHHHHHhhcccccccc----cccc----
Confidence            45899999999999999999999999               999999999998765332210 00000    0000    


Q ss_pred             CCCCCCcchhhhccCceEEEEccCCChHHHHHHHHHHHhCCCeEEEeccccccccccccchhhHHHHHHHhhchhHHHhc
Q 038067          149 GNCNVENDEIVELEKSNVLLMGPTGSGKTLLAKTLARIVNVPFTITDATALTQAGYVGEDAESVLYKLLAAADFDVEAAQ  228 (510)
Q Consensus       149 g~~~~~~~~~~~~~~~~vLL~GPpGtGKT~lAr~lA~~l~~p~~~~~~s~l~~~gy~G~~~~~~l~~l~~~~~~~~~~~~  228 (510)
                            ...+..+++.|+||+||||||||.+||+||+.++.||+.+||+.+++.||+|+++++.++.++..+++.++.++
T Consensus        60 ------~~~~~~~p~~niLfiGPTGvGKTElAk~LA~~~~~~~ir~D~s~~~e~gyvg~dv~~~i~~l~~~~~~~v~~~~  133 (364)
T d1um8a_          60 ------HLEEVELSKSNILLIGPTGSGKTLMAQTLAKHLDIPIAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQ  133 (364)
T ss_dssp             ------HHHHTTCCCCCEEEECCTTSSHHHHHHHHHHHTTCCEEEEEGGGCC--------CTHHHHHHHHHTTTCHHHHT
T ss_pred             ------ccccccCCCcceeeeCCCCccHHHHHHHHHhhcccceeehhhhhcccchhhHhhhccchhhhhhhchhHHHHhh
Confidence                  00223558999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEEcchhhhhhh-ccCCCCCCCchhhHHHHHHHHhhCceeeeccCCCCCCCCCCCCcEEEEcCCceeecCCCccchH
Q 038067          229 RGIVYIDEVDKIVKA-ESRNNGRDVSGEGVQQALLKMLEGTVVNVPIPDNGPRKHPRGDNIPIDTKDILFICGGAFVGLE  307 (510)
Q Consensus       229 ~~Vl~iDEidkl~~~-~~~~~~~~~~~~~v~~~LL~~leg~~~~i~~~~~g~~~~~~~~~i~i~tsnilfI~tg~~~~l~  307 (510)
                      ++|++|||++|+.+. .....+.+.++..|++.||++||++..+++  +.++++....+.+.++|+|++|+++|++.+++
T Consensus       134 ~~iv~lDEieK~~~~s~~~~~~~d~a~~~V~~~lLqild~~~~~~~--~~~gr~~~~~~~i~i~t~~i~~~~~ga~~~~~  211 (364)
T d1um8a_         134 KGIVFIDEIDKISRLSENRSITRDVSGEGVQQALLKIVEGSLVNIP--PKGGRKHPEGNFIQIDTSDILFICAGAFDGLA  211 (364)
T ss_dssp             TSEEEEETGGGC--------------CHHHHHHHHHHHHCCEEC-----------------CEECTTCEEEEEECCTTHH
T ss_pred             cccchhhhhhhhccccccccccccccchHHHHhhhhhhcCceeccC--CCCCCcCCcceeEEEeehhhhhhhcccchhhh
Confidence            999999999998743 233456777888999999999999988877  78888888889999999999999999999999


Q ss_pred             HHHHhhcccCCCCcCcccccccccCCCchhhhhhhhhhccCchhhhhcCCchhhhcccCceEecCCCCHHHHHHHHhchh
Q 038067          308 KTISERRQDSSIGFGAPVRANMRTGGLTDALVTSSLLESVDSGDLVAYGLIPEFIGRFPILVSLSALNEDQLVQVLMEPK  387 (510)
Q Consensus       308 ~~i~~~~~~~~~gf~~~~~~~~~~~~~~~~~~~~~~l~~~~~~dl~~~~~~Pefl~R~~~iv~f~~Ls~eel~~Il~~~~  387 (510)
                      +....+.....++|.......         ......++.+.+.++++++|+|||+||||.+|.|++|+++++.+|+..++
T Consensus       212 ~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~f~PEf~gRi~~iv~f~~L~~~~l~~Il~~~~  282 (364)
T d1um8a_         212 EIIKKRTTQNVLGFTQEKMSK---------KEQEAILHLVQTHDLVTYGLIPELIGRLPVLSTLDSISLEAMVDILQKPK  282 (364)
T ss_dssp             HHTTTSCSSCCCSCCCSSCCT---------TTTTTSGGGCCHHHHHHTTCCHHHHTTCCEEEECCCCCHHHHHHHHHSST
T ss_pred             hhhhhhcccccccccccccch---------hhhhhhhccccHHHHhhhhhHHHHHHHhcchhhHhhhhHHHHHHHHHHHH
Confidence            999999888888887654332         23345667788889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCceeeeCHHHHHHHHHhhCCCCCChhHHHHHHHHHHHHHHhcCcCCCCCCCcccEEEEccccccCc
Q 038067          388 NALGRQYKKMFSMNNVKLHFTDDALRLIAKKAMAKNTGARGLRALLENILTEAMFEIPETKIGTSSVNAVLVDKEAVGSV  467 (510)
Q Consensus       388 ~~l~~~~~~~~~~~~~~l~is~~al~~La~~~~~~~~gaR~L~~~ie~~l~~~l~~~~~~~~~~~~i~~~~v~~~~v~~~  467 (510)
                      +.+++||+.++..+++.+.|+++++++|++.+|+.++|||+|+++||+++.+.++++|..+     .+.++||.+.|...
T Consensus       283 ~~l~kq~~~~l~~~gi~L~~td~a~~~la~~g~d~~~GAR~L~riie~~l~~~~f~~p~~~-----~~~v~I~~~~V~~~  357 (364)
T d1um8a_         283 NALIKQYQQLFKMDEVDLIFEEEAIKEIAQLALERKTGARGLRAIIEDFCLDIMFDLPKLK-----GSEVRITKDCVLKQ  357 (364)
T ss_dssp             TCHHHHHHHHHHTTTCEEEECHHHHHHHHHHHHHTTCTGGGHHHHHHHHHHHHHHTGGGGT-----TSEEEECHHHHTTS
T ss_pred             HHHHHHHHHHHHhCCcEEEECHHHHHHHHHhccCCCCCchHHHHHHHHHHHHHhccCCCCC-----CCEEEECHHHhCCC
Confidence            9999999999999999999999999999999999999999999999999999999999874     57899999998866


Q ss_pred             CCC
Q 038067          468 DAP  470 (510)
Q Consensus       468 ~~~  470 (510)
                      ..|
T Consensus       358 ~~~  360 (364)
T d1um8a_         358 AEP  360 (364)
T ss_dssp             SCC
T ss_pred             CCC
Confidence            554
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure