Citrus Sinensis ID: 038128


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MEAANVQGQPLEVTVIACKGLKDTEWLSKQDPYVYGGKNPTFQEKFMFPLIHGVNEMNLVVWNSNTITGDDFIGSGKVQLTKAITQGYDDNPWPLWTRSGKHAGEVNIILRCANVWNFLVLYLSSFILNTGMTSPAYEHGPAVSYPSSDPPPYHPPAGYGGYPPQPPPSGYPQPSAYAPPPGPHPYGAPHPAPGPYPYGAPPNQHPNGPPPGAHPYGAPPGPPSYGYGAPQHGHGGDYILRHN
ccccccccccEEEEEEEcccccccccccccccEEEcccccccccEEEEEccccccEEEEEEECccccccccccEEEEEEcHHHHHcccccccCEEEccccCCcCEEEEEEEEEEccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccc
**********LEVTVIACKGLKDTEWLSKQDPYVYGGKNPTFQEKFMFPLIHGVNEMNLVVWNSNTITGDDFIGSGKVQLTKAITQGYDDNPWPLWTRSGKHAGEVNIILRCANVWNFLVLYLSS*ILNTGMT**************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAANVQGQPLEVTVIACKGLKDTEWLSKQDPYVYGGKNPTFQEKFMFPLIHGVNEMNLVVWNSNTITGDDFIGSGKVQLTKAITQGYDDNPWPLWTRSGKHAGEVNIILRCANVWNFLVLYLSSFILNTGMTSPAYEHGPAVSYPSSDPPPYHPPAGYGGYPPQPPPSGYPQPSAYAPPPGPHPYGAPHPAPGPYPYGAPPNQHPNGPPPGAHPYGAPPGPPSYGYGAPQHGHGGDYILRHN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DQV, chain A
Confidence level:very confident
Coverage over the Query: 6-117
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 181-193
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3h0g, chain A probable Alignment | Template Structure