Citrus Sinensis ID: 038201
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| 224139258 | 221 | predicted protein [Populus trichocarpa] | 0.905 | 0.823 | 0.747 | 2e-75 | |
| 225439530 | 227 | PREDICTED: abscisic acid receptor PYL4-l | 0.920 | 0.814 | 0.748 | 2e-75 | |
| 225448560 | 212 | PREDICTED: abscisic acid receptor PYL4 [ | 0.965 | 0.915 | 0.692 | 9e-74 | |
| 224087819 | 165 | predicted protein [Populus trichocarpa] | 0.805 | 0.981 | 0.814 | 1e-72 | |
| 255559545 | 209 | conserved hypothetical protein [Ricinus | 0.815 | 0.784 | 0.774 | 1e-71 | |
| 449439845 | 206 | PREDICTED: abscisic acid receptor PYL4-l | 0.965 | 0.941 | 0.66 | 2e-70 | |
| 449483565 | 206 | PREDICTED: abscisic acid receptor PYL4-l | 0.965 | 0.941 | 0.66 | 2e-70 | |
| 62867576 | 213 | hypothetical protein [Nicotiana tabacum] | 0.990 | 0.934 | 0.661 | 4e-70 | |
| 449461793 | 205 | PREDICTED: abscisic acid receptor PYL4-l | 0.970 | 0.951 | 0.661 | 4e-68 | |
| 449460874 | 242 | PREDICTED: abscisic acid receptor PYL4-l | 0.840 | 0.698 | 0.690 | 2e-66 |
| >gi|224139258|ref|XP_002323024.1| predicted protein [Populus trichocarpa] gi|222867654|gb|EEF04785.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 287 bits (734), Expect = 2e-75, Method: Compositional matrix adjust.
Identities = 136/182 (74%), Positives = 152/182 (83%)
Query: 20 QKQPQPTTLSRFPVPETLPFYHKHTVGPNQCCSYAVQTINAPLPAVWSVVRRFDNPQAYK 79
QK+ P PVPET+ YH H VGPNQCCS VQ I AP+ VWSVVRRFDNPQAYK
Sbjct: 36 QKRWSPLPCDATPVPETVSRYHTHAVGPNQCCSAVVQQIAAPISTVWSVVRRFDNPQAYK 95
Query: 80 HFLKSCHVINGDGHVGTLREVHVISGLPAANSTERLEILDDEHHVLSFSVIGGDHRLNNY 139
HF+KSCHVI GDG VGTLRE+HVISGLPAA+STERLEILDDE HV+SFSV+GGDHRL NY
Sbjct: 96 HFVKSCHVILGDGDVGTLREIHVISGLPAAHSTERLEILDDERHVISFSVVGGDHRLANY 155
Query: 140 RSVTTLHASPCGTGTVVVESYVCDVPPGNTREETCTFVDTIVRCNLQSLAQISENMAARS 199
+SVTTLH+SP G GTVV+ESY D+PPGNT+E+TC FVDTIVRCNLQSLAQI+EN R+
Sbjct: 156 KSVTTLHSSPSGNGTVVMESYAVDIPPGNTKEDTCVFVDTIVRCNLQSLAQIAENSNRRN 215
Query: 200 NK 201
NK
Sbjct: 216 NK 217
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225439530|ref|XP_002264158.1| PREDICTED: abscisic acid receptor PYL4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225448560|ref|XP_002277562.1| PREDICTED: abscisic acid receptor PYL4 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224087819|ref|XP_002308236.1| predicted protein [Populus trichocarpa] gi|222854212|gb|EEE91759.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255559545|ref|XP_002520792.1| conserved hypothetical protein [Ricinus communis] gi|223539923|gb|EEF41501.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449439845|ref|XP_004137696.1| PREDICTED: abscisic acid receptor PYL4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449483565|ref|XP_004156626.1| PREDICTED: abscisic acid receptor PYL4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|62867576|emb|CAI84653.1| hypothetical protein [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|449461793|ref|XP_004148626.1| PREDICTED: abscisic acid receptor PYL4-like [Cucumis sativus] gi|449531513|ref|XP_004172730.1| PREDICTED: abscisic acid receptor PYL4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449460874|ref|XP_004148169.1| PREDICTED: abscisic acid receptor PYL4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| TAIR|locus:2057175 | 207 | PYL4 "PYR1-like 4" [Arabidopsi | 0.850 | 0.826 | 0.738 | 2.8e-66 | |
| TAIR|locus:2153549 | 203 | PYL5 "PYRABACTIN RESISTANCE 1- | 0.781 | 0.773 | 0.698 | 6.6e-58 | |
| TAIR|locus:2063063 | 215 | PYL6 "PYR1-like 6" [Arabidopsi | 0.805 | 0.753 | 0.634 | 7e-54 | |
| TAIR|locus:2035227 | 187 | RCAR1 "regulatory component of | 0.786 | 0.844 | 0.571 | 6.2e-46 | |
| TAIR|locus:2163731 | 188 | RCAR3 "regulatory components o | 0.786 | 0.840 | 0.559 | 1.3e-45 | |
| TAIR|locus:505006424 | 211 | PYL7 "PYR1-like 7" [Arabidopsi | 0.810 | 0.772 | 0.536 | 1.2e-44 | |
| TAIR|locus:2152430 | 159 | PYL12 "PYR1-like 12" [Arabidop | 0.726 | 0.918 | 0.623 | 2.4e-44 | |
| TAIR|locus:2057407 | 190 | PYL2 "PYR1-like 2" [Arabidopsi | 0.766 | 0.810 | 0.552 | 7.3e-43 | |
| TAIR|locus:2152420 | 161 | PYL11 "AT5G45860" [Arabidopsis | 0.731 | 0.913 | 0.614 | 3.2e-42 | |
| TAIR|locus:2132917 | 183 | PYL10 "PYR1-like 10" [Arabidop | 0.815 | 0.896 | 0.511 | 5.2e-42 |
| TAIR|locus:2057175 PYL4 "PYR1-like 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 674 (242.3 bits), Expect = 2.8e-66, P = 2.8e-66
Identities = 130/176 (73%), Positives = 147/176 (83%)
Query: 30 RFPV---PETLPFYHKHTVGPNQCCSYAVQTINAPLPAVWSVVRRFDNPQAYKHFLKSCH 86
RFP T +H H VGPNQCCS +Q I+AP+ VWSVVRRFDNPQAYKHFLKSC
Sbjct: 29 RFPSLSRDSTAARFHTHEVGPNQCCSAVIQEISAPISTVWSVVRRFDNPQAYKHFLKSCS 88
Query: 87 VINGDG-HVGTLREVHVISGLPAANSTERLEILDDEHHVLSFSVIGGDHRLNNYRSVTTL 145
VI GDG +VG+LR+VHV+SGLPAA+STERL+ILDDE HV+SFSV+GGDHRL+NYRSVTTL
Sbjct: 89 VIGGDGDNVGSLRQVHVVSGLPAASSTERLDILDDERHVISFSVVGGDHRLSNYRSVTTL 148
Query: 146 HASPCGTGTVVVESYVCDVPPGNTREETCTFVDTIVRCNLQSLAQISENMAARSNK 201
H SP +GTVVVESYV DVPPGNT+EETC FVD IVRCNLQSLA+I+EN AA S K
Sbjct: 149 HPSPI-SGTVVVESYVVDVPPGNTKEETCDFVDVIVRCNLQSLAKIAENTAAESKK 203
|
|
| TAIR|locus:2153549 PYL5 "PYRABACTIN RESISTANCE 1-LIKE 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2063063 PYL6 "PYR1-like 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035227 RCAR1 "regulatory component of ABA receptor 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163731 RCAR3 "regulatory components of ABA receptor 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006424 PYL7 "PYR1-like 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152430 PYL12 "PYR1-like 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057407 PYL2 "PYR1-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152420 PYL11 "AT5G45860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132917 PYL10 "PYR1-like 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00037390001 | SubName- Full=Chromosome chr8 scaffold_88, whole genome shotgun sequence; (215 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| cd07821 | 140 | cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance | 3e-34 | |
| cd07816 | 148 | cd07816, Bet_v1-like, Ligand-binding bet_v_1 domai | 2e-14 | |
| pfam10604 | 140 | pfam10604, Polyketide_cyc2, Polyketide cyclase / d | 8e-13 | |
| pfam00407 | 150 | pfam00407, Bet_v_1, Pathogenesis-related protein B | 1e-07 | |
| smart01037 | 151 | smart01037, Bet_v_1, Pathogenesis-related protein | 1e-05 |
| >gnl|CDD|176863 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
Score = 118 bits (297), Expect = 3e-34
Identities = 38/144 (26%), Positives = 57/144 (39%), Gaps = 4/144 (2%)
Query: 50 CCSYAVQTINAPLPAVWSVVRRFDNPQAYKHFLKSCHVINGDGHVGTLREVHVISGLPAA 109
TI+AP VW+++ F + + SC + G VG +R V + G
Sbjct: 1 AKVTVSVTIDAPADKVWALLSDFGGLHKWHPAVASCELEGGGPGVGAVRTVTLKDG---G 57
Query: 110 NSTERLEILDDEHHVLSFSVIGGDHRLNNYRSVTTLHASPCGTGTVVVESYVCDVPPGNT 169
ERL LDD S+ ++ G + NY + + GT V + D P G T
Sbjct: 58 TVRERLLALDDAERRYSYRIVEGPLPVKNYVATIRVTPEG-DGGTRVTWTAEFDPPEGLT 116
Query: 170 REETCTFVDTIVRCNLQSLAQISE 193
E F+ + R L +L E
Sbjct: 117 DELARAFLTGVYRAGLAALKAALE 140
|
The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol. Length = 140 |
| >gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|220822 pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport | Back alignment and domain information |
|---|
| >gnl|CDD|215904 pfam00407, Bet_v_1, Pathogenesis-related protein Bet v I family | Back alignment and domain information |
|---|
| >gnl|CDD|198105 smart01037, Bet_v_1, Pathogenesis-related protein Bet v I family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| cd07816 | 148 | Bet_v1-like Ligand-binding bet_v_1 domain of major | 99.96 | |
| PF00407 | 151 | Bet_v_1: Pathogenesis-related protein Bet v I fami | 99.93 | |
| cd07821 | 140 | PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), | 99.72 | |
| PF10604 | 139 | Polyketide_cyc2: Polyketide cyclase / dehydrase an | 99.67 | |
| cd08866 | 144 | SRPBCC_11 Ligand-binding SRPBCC domain of an uncha | 99.58 | |
| cd08861 | 142 | OtcD1_ARO-CYC_like N-terminal and C-terminal aroma | 99.44 | |
| cd08865 | 140 | SRPBCC_10 Ligand-binding SRPBCC domain of an uncha | 99.41 | |
| cd08862 | 138 | SRPBCC_Smu440-like Ligand-binding SRPBCC domain of | 99.29 | |
| cd07819 | 140 | SRPBCC_2 Ligand-binding SRPBCC domain of an unchar | 99.29 | |
| cd07818 | 150 | SRPBCC_1 Ligand-binding SRPBCC domain of an unchar | 99.26 | |
| cd07813 | 138 | COQ10p_like Coenzyme Q-binding protein COQ10p and | 99.25 | |
| cd07814 | 139 | SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- | 99.22 | |
| cd07817 | 139 | SRPBCC_8 Ligand-binding SRPBCC domain of an unchar | 99.21 | |
| cd07812 | 141 | SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR | 99.19 | |
| cd07822 | 141 | SRPBCC_4 Ligand-binding SRPBCC domain of an unchar | 99.17 | |
| cd07825 | 144 | SRPBCC_7 Ligand-binding SRPBCC domain of an unchar | 99.09 | |
| cd08860 | 146 | TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom | 99.08 | |
| cd07824 | 146 | SRPBCC_6 Ligand-binding SRPBCC domain of an unchar | 98.89 | |
| PF03364 | 130 | Polyketide_cyc: Polyketide cyclase / dehydrase and | 98.86 | |
| cd05018 | 144 | CoxG Carbon monoxide dehydrogenase subunit G (CoxG | 98.78 | |
| cd07820 | 137 | SRPBCC_3 Ligand-binding SRPBCC domain of an unchar | 98.7 | |
| PRK10724 | 158 | hypothetical protein; Provisional | 98.49 | |
| cd08893 | 136 | SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobi | 98.38 | |
| cd08899 | 157 | SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan | 98.36 | |
| cd08898 | 145 | SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligan | 98.36 | |
| cd07823 | 146 | SRPBCC_5 Ligand-binding SRPBCC domain of an unchar | 98.35 | |
| cd08894 | 139 | SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan | 98.18 | |
| COG3427 | 146 | Carbon monoxide dehydrogenase subunit G, CoxG [Ene | 98.14 | |
| cd07826 | 142 | SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligan | 98.09 | |
| cd08900 | 143 | SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligan | 98.08 | |
| PF06240 | 140 | COXG: Carbon monoxide dehydrogenase subunit G (Cox | 97.99 | |
| cd08896 | 146 | SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligan | 97.99 | |
| cd08895 | 146 | SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligan | 97.98 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 97.91 | |
| cd08897 | 133 | SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligan | 97.69 | |
| COG5637 | 217 | Predicted integral membrane protein [Function unkn | 97.68 | |
| cd08891 | 149 | SRPBCC_CalC Ligand-binding SRPBCC domain of Microm | 97.63 | |
| PF08327 | 124 | AHSA1: Activator of Hsp90 ATPase homolog 1-like pr | 97.26 | |
| COG3832 | 149 | Uncharacterized conserved protein [Function unknow | 97.17 | |
| cd08892 | 126 | SRPBCC_Aha1 Putative hydrophobic ligand-binding SR | 97.15 | |
| cd08901 | 136 | SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligan | 97.06 | |
| PF08982 | 149 | DUF1857: Domain of unknown function (DUF1857); Int | 96.97 | |
| cd08863 | 141 | SRPBCC_DUF1857 DUF1857, an uncharacterized ligand- | 96.92 | |
| COG4276 | 153 | Uncharacterized conserved protein [Function unknow | 96.58 | |
| COG2867 | 146 | Oligoketide cyclase/lipid transport protein [Lipid | 96.13 | |
| PTZ00220 | 132 | Activator of HSP-90 ATPase; Provisional | 95.43 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 94.85 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 94.5 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 94.46 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 94.32 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 94.16 | |
| PF10698 | 159 | DUF2505: Protein of unknown function (DUF2505); In | 94.1 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 93.88 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 93.86 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 93.7 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 93.33 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 92.72 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 92.06 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 90.73 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 90.56 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 87.9 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 82.65 |
| >cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins | Back alignment and domain information |
|---|
Probab=99.96 E-value=3.1e-28 Score=193.91 Aligned_cols=116 Identities=19% Similarity=0.320 Sum_probs=106.4
Q ss_pred EEEEEEEcCChHHHHHHHhCCCC--CccccccceEEEEecCCCCCCeEEEEEEecCCCcceeEEEEeeecCCCcEEEEEE
Q 038201 52 SYAVQTINAPLPAVWSVVRRFDN--PQAYKHFLKSCHVINGDGHVGTLREVHVISGLPAANSTERLEILDDEHHVLSFSV 129 (201)
Q Consensus 52 s~v~~~I~ApadkVW~vv~dF~~--pk~~p~~V~s~e~~eGdg~vGsvR~vt~~~G~p~~~v~ERL~~lDde~~~~sY~v 129 (201)
...+++|+||+|+||+++++|++ ++.|+|+|++|++++|+|++||||.|+|.+|++..+++|||+++|+++|+|+|++
T Consensus 3 ~~~e~~i~a~ad~vW~~~~~~~~~~~~~~~p~v~~~~~~eG~~~~GsvR~~~~~~~~~~~~~kE~l~~~D~~~~~~~y~v 82 (148)
T cd07816 3 LEHEVELKVPAEKLWKAFVLDSHLLPPKLPPVIKSVELLEGDGGPGSIKLITFGPGGKVKYVKERIDAVDEENKTYKYTV 82 (148)
T ss_pred EEEEEEecCCHHHHHHHHhcChhhccccccccccEEEEEecCCCCceEEEEEEcCCCcceEEEEEEEEEcccccEEEEEE
Confidence 35679999999999999999994 8889999999999999999999999999988777799999999999999999999
Q ss_pred EecccC---CCCeeEEEEEEeecCCCceEEEEEEEeeCCCCC
Q 038201 130 IGGDHR---LNNYRSVTTLHASPCGTGTVVVESYVCDVPPGN 168 (201)
Q Consensus 130 veg~~~---~~~Y~ati~v~p~~~~~~T~v~Ws~~~d~p~g~ 168 (201)
++|+.+ +++|+++++|.|.+ +++|++.|++.|++.++.
T Consensus 83 veg~~~~~~~~~y~~t~~v~~~~-~~~t~v~Wt~~ye~~~~~ 123 (148)
T cd07816 83 IEGDVLKDGYKSYKVEIKFVPKG-DGGCVVKWTIEYEKKGDA 123 (148)
T ss_pred EecccccCceEEEEEEEEEEECC-CCCEEEEEEEEEEECCCC
Confidence 999984 99999999999984 578999999999977664
|
This family includes the ligand binding domain of Bet v 1 (the major pollen allergen of white birch, Betula verrucosa) and related proteins. In addition to birch Bet v 1, this family includes other plant intracellular pathogenesis-related class 10 (PR-10) proteins, norcoclaurine synthases (NCSs), cytokinin binding proteins (CSBPs), major latex proteins (MLPs), and ripening-related proteins. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Members of this family binds a diverse range of ligands. Bet v 1 can bind brassinosteroids, cytokinins, flavonoids and fatty acids. Hyp-1, a PR-10 from Hypericum perforatum/St. John's wort, catalyzes the condensation of two molecules of emodin to the bioactive naphthodianth |
| >PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms | Back alignment and domain information |
|---|
| >cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
| >PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis | Back alignment and domain information |
|---|
| >cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains | Back alignment and domain information |
|---|
| >cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu | Back alignment and domain information |
|---|
| >cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins | Back alignment and domain information |
|---|
| >cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins | Back alignment and domain information |
|---|
| >cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily | Back alignment and domain information |
|---|
| >cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains | Back alignment and domain information |
|---|
| >cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp | Back alignment and domain information |
|---|
| >cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) | Back alignment and domain information |
|---|
| >cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PRK10724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08893 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins; some contain an N-terminal GntR family winged HTH DNA-binding domain | Back alignment and domain information |
|---|
| >cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08898 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08900 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster | Back alignment and domain information |
|---|
| >cd08896 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08895 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08897 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >COG5637 Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >cd08891 SRPBCC_CalC Ligand-binding SRPBCC domain of Micromonospora echinospora CalC and related proteins | Back alignment and domain information |
|---|
| >PF08327 AHSA1: Activator of Hsp90 ATPase homolog 1-like protein; InterPro: IPR013538 This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90 kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG3832 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd08892 SRPBCC_Aha1 Putative hydrophobic ligand-binding SRPBCC domain of the Hsp90 co-chaperone Aha1 and related proteins | Back alignment and domain information |
|---|
| >cd08901 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >PF08982 DUF1857: Domain of unknown function (DUF1857); InterPro: IPR015075 This protein has no known function | Back alignment and domain information |
|---|
| >cd08863 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily | Back alignment and domain information |
|---|
| >COG4276 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PTZ00220 Activator of HSP-90 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 201 | ||||
| 3qrz_B | 223 | Crystal Structure Of Native Abscisic Acid Receptor | 1e-61 | ||
| 3oqu_A | 205 | Crystal Structure Of Native Abscisic Acid Receptor | 3e-49 | ||
| 3kdh_A | 190 | Structure Of Ligand-Free Pyl2 Length = 190 | 2e-47 | ||
| 3nj0_A | 193 | X-Ray Crystal Structure Of The Pyl2-Pyrabactin A Co | 3e-47 | ||
| 3kaz_A | 176 | Crystal Structure Of Abscisic Acid Receptor Pyl2 Le | 3e-47 | ||
| 3nmh_A | 178 | Crystal Structure Of The Abscisic Receptor Pyl2 In | 3e-47 | ||
| 3nj1_A | 193 | X-Ray Crystal Structure Of The Pyl2(V114i)-Pyrabact | 4e-47 | ||
| 3ujl_A | 177 | Crystal Structure Of Abscisic Acid Bound Pyl2 In Co | 4e-47 | ||
| 3nmp_A | 178 | Crystal Structure Of The Abscisic Receptor Pyl2 Mut | 2e-46 | ||
| 3uqh_A | 191 | Crystal Strcuture Of Aba Receptor Pyl10 (Apo) Lengt | 2e-46 | ||
| 3rt2_A | 183 | Crystal Structure Of Apo-Pyl10 Length = 183 | 2e-46 | ||
| 3rt0_C | 183 | Crystal Structure Of Pyl10-Hab1 Complex In The Abse | 2e-45 | ||
| 3k90_A | 193 | The Abscisic Acid Receptor Pyr1 In Complex With Abs | 3e-45 | ||
| 3k3k_A | 211 | Crystal Structure Of Dimeric Abscisic Acid (Aba) Re | 7e-45 | ||
| 3njo_A | 194 | X-Ray Crystal Structure Of The Pyr1-Pyrabactin A Co | 3e-44 | ||
| 3zvu_A | 193 | Structure Of The Pyr1 His60pro Mutant In Complex Wi | 5e-44 | ||
| 4dsc_A | 188 | Complex Structure Of Abscisic Acid Receptor Pyl3 Wi | 2e-41 | ||
| 4dsb_A | 186 | Complex Structure Of Abscisic Acid Receptor Pyl3 Wi | 2e-41 | ||
| 3oji_A | 189 | X-Ray Crystal Structure Of The Py13 -Pyrabactin Com | 2e-41 | ||
| 3klx_A | 209 | Crystal Structure Of Native Abscisic Acid Receptor | 3e-41 | ||
| 3kdj_A | 202 | Complex Structure Of (+)-Aba-Bound Pyl1 And Abi1 Le | 2e-38 | ||
| 3jrs_A | 208 | Crystal Structure Of (+)-Aba-Bound Pyl1 Length = 20 | 3e-38 | ||
| 3kay_A | 178 | Crystal Structure Of Abscisic Acid Receptor Pyl1 Le | 3e-38 | ||
| 3jrq_B | 186 | Crystal Structure Of (+)-aba-bound Pyl1 In Complex | 4e-38 |
| >pdb|3OQU|A Chain A, Crystal Structure Of Native Abscisic Acid Receptor Pyl9 With Aba Length = 205 | Back alignment and structure |
| >pdb|3KDH|A Chain A, Structure Of Ligand-Free Pyl2 Length = 190 | Back alignment and structure |
| >pdb|3NJ0|A Chain A, X-Ray Crystal Structure Of The Pyl2-Pyrabactin A Complex Length = 193 | Back alignment and structure |
| >pdb|3KAZ|A Chain A, Crystal Structure Of Abscisic Acid Receptor Pyl2 Length = 176 | Back alignment and structure |
| >pdb|3NMH|A Chain A, Crystal Structure Of The Abscisic Receptor Pyl2 In Complex With Pyrabactin Length = 178 | Back alignment and structure |
| >pdb|3NJ1|A Chain A, X-Ray Crystal Structure Of The Pyl2(V114i)-Pyrabactin A Complex Length = 193 | Back alignment and structure |
| >pdb|3UJL|A Chain A, Crystal Structure Of Abscisic Acid Bound Pyl2 In Complex With Type 2c Protein Phosphatase Abi2 Length = 177 | Back alignment and structure |
| >pdb|3NMP|A Chain A, Crystal Structure Of The Abscisic Receptor Pyl2 Mutant A93f In Complex With Pyrabactin Length = 178 | Back alignment and structure |
| >pdb|3UQH|A Chain A, Crystal Strcuture Of Aba Receptor Pyl10 (Apo) Length = 191 | Back alignment and structure |
| >pdb|3RT2|A Chain A, Crystal Structure Of Apo-Pyl10 Length = 183 | Back alignment and structure |
| >pdb|3RT0|C Chain C, Crystal Structure Of Pyl10-Hab1 Complex In The Absence Of Abscisic Acid (Aba) Length = 183 | Back alignment and structure |
| >pdb|3K90|A Chain A, The Abscisic Acid Receptor Pyr1 In Complex With Abscisic Acid Length = 193 | Back alignment and structure |
| >pdb|3K3K|A Chain A, Crystal Structure Of Dimeric Abscisic Acid (Aba) Receptor Pyrabactin Resistance 1 (Pyr1) With Aba-Bound Closed-Lid And Aba-Free Open-Lid Subunits Length = 211 | Back alignment and structure |
| >pdb|3NJO|A Chain A, X-Ray Crystal Structure Of The Pyr1-Pyrabactin A Complex Length = 194 | Back alignment and structure |
| >pdb|3ZVU|A Chain A, Structure Of The Pyr1 His60pro Mutant In Complex With The Hab1 Phosphatase And Abscisic Acid Length = 193 | Back alignment and structure |
| >pdb|4DSC|A Chain A, Complex Structure Of Abscisic Acid Receptor Pyl3 With (+)-Aba In Spacegroup Of H32 At 1.95a Length = 188 | Back alignment and structure |
| >pdb|4DSB|A Chain A, Complex Structure Of Abscisic Acid Receptor Pyl3 With (+)-Aba In Spacegroup Of I 212121 At 2.70a Length = 186 | Back alignment and structure |
| >pdb|3OJI|A Chain A, X-Ray Crystal Structure Of The Py13 -Pyrabactin Complex Length = 189 | Back alignment and structure |
| >pdb|3KLX|A Chain A, Crystal Structure Of Native Abscisic Acid Receptor Pyl3 Length = 209 | Back alignment and structure |
| >pdb|3KDJ|A Chain A, Complex Structure Of (+)-Aba-Bound Pyl1 And Abi1 Length = 202 | Back alignment and structure |
| >pdb|3JRS|A Chain A, Crystal Structure Of (+)-Aba-Bound Pyl1 Length = 208 | Back alignment and structure |
| >pdb|3KAY|A Chain A, Crystal Structure Of Abscisic Acid Receptor Pyl1 Length = 178 | Back alignment and structure |
| >pdb|3JRQ|B Chain B, Crystal Structure Of (+)-aba-bound Pyl1 In Complex With Abi1 Length = 186 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| 3k3k_A | 211 | Abscisic acid receptor PYR1; ABA receptor, plant h | 3e-81 | |
| 3jrs_A | 208 | PYL1, putative uncharacterized protein AT5G46790; | 9e-81 | |
| 3oji_A | 189 | Abscisic acid receptor PYL3; crystal, PP2C, pyraba | 5e-77 | |
| 3kl1_A | 190 | PYL2, putative uncharacterized protein AT2G26040; | 2e-75 | |
| 3rt2_A | 183 | Abscisic acid receptor PYL10; ABA-independent PP2C | 9e-71 | |
| 3oqu_A | 205 | Abscisic acid receptor PYL9; RCAR1, hormone recept | 1e-68 | |
| 3qrz_A | 223 | Abscisic acid receptor PYL5; crystal, hormone rece | 7e-63 | |
| 3f08_A | 146 | Uncharacterized protein Q6HG14; NESG Q6HG14_bachk | 3e-32 | |
| 2le1_A | 151 | Uncharacterized protein; structural genomics, nort | 7e-30 | |
| 3p51_A | 160 | Uncharacterized protein; structural genomics, PSI- | 3e-28 | |
| 2i9y_A | 166 | Major latex protein-like protein 28 or MLP-like pr | 3e-24 | |
| 2vq5_A | 201 | S-norcoclaurine synthase; lyase, S- norcoclaurine | 2e-23 | |
| 2flh_A | 155 | Cytokinin-specific binding protein; zeatin, pathog | 2e-23 | |
| 1e09_A | 159 | PRU AV 1; allergen, major cherry allergen, pathoge | 9e-20 | |
| 4a8u_A | 159 | Major pollen allergen BET V 1-J; PR-10 protein; 1. | 5e-19 | |
| 3ie5_A | 165 | Phenolic oxidative coupling protein HYP-1; hyperic | 5e-18 | |
| 2vjg_A | 154 | Major allergen DAU C 1; major carrot allergen, pat | 1e-17 | |
| 1tw0_A | 157 | Pathogenesis-related class 10 protein SPE-16; seve | 2e-15 | |
| 1icx_A | 155 | Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, | 2e-14 | |
| 2qim_A | 158 | PR10.2B; trans-zeatin, cytokinin, plant hormones, | 9e-14 | |
| 3rws_A | 168 | MTN13 protein; zeatin, cytokinin, hormone, lucerne | 1e-11 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 6e-04 |
| >3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Length = 211 | Back alignment and structure |
|---|
Score = 239 bits (611), Expect = 3e-81
Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 6/199 (3%)
Query: 9 RRANNTTPTPPQKQPQPTTLS---RFPVPETLPFYHKHTVGPNQCCSYAVQTINAPLPAV 65
++++ P+ P+ L+ R + ++ +H + + P C S Q I+AP V
Sbjct: 6 HHHHHSSGLVPRGSHMPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELV 65
Query: 66 WSVVRRFDNPQAYKHFLKSCHVING-DGHVGTLREVHVISGLPAANSTERLEILDDEHHV 124
WS+VRRFD PQ YKHF+KSC V + VG R+V VISGLPA STERL+ILDDE V
Sbjct: 66 WSIVRRFDKPQTYKHFIKSCSVEQNFEMRVGCTRDVIVISGLPANTSTERLDILDDERRV 125
Query: 125 LSFSVIGGDHRLNNYRSVTTLHASPCG--TGTVVVESYVCDVPPGNTREETCTFVDTIVR 182
FS+IGG+HRL NY+SVTT+H TVV+ESYV D+P GN+ ++T F DT+V+
Sbjct: 126 TGFSIIGGEHRLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFADTVVK 185
Query: 183 CNLQSLAQISENMAARSNK 201
NLQ LA ++E MA S
Sbjct: 186 LNLQKLATVAEAMARNSGD 204
|
| >3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Length = 208 | Back alignment and structure |
|---|
| >3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 3klx_A Length = 189 | Back alignment and structure |
|---|
| >3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Length = 190 | Back alignment and structure |
|---|
| >3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Length = 183 | Back alignment and structure |
|---|
| >3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Length = 205 | Back alignment and structure |
|---|
| >3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} PDB: 3cnw_A Length = 146 | Back alignment and structure |
|---|
| >2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Length = 151 | Back alignment and structure |
|---|
| >3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Length = 160 | Back alignment and structure |
|---|
| >2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Length = 201 | Back alignment and structure |
|---|
| >2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Length = 155 | Back alignment and structure |
|---|
| >1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Length = 159 | Back alignment and structure |
|---|
| >4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Length = 159 | Back alignment and structure |
|---|
| >3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} Length = 165 | Back alignment and structure |
|---|
| >1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Length = 157 | Back alignment and structure |
|---|
| >1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Length = 155 | Back alignment and structure |
|---|
| >2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Length = 158 | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Length = 147 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| 3oji_A | 189 | Abscisic acid receptor PYL3; crystal, PP2C, pyraba | 100.0 | |
| 3rt2_A | 183 | Abscisic acid receptor PYL10; ABA-independent PP2C | 100.0 | |
| 3kl1_A | 190 | PYL2, putative uncharacterized protein AT2G26040; | 100.0 | |
| 3jrs_A | 208 | PYL1, putative uncharacterized protein AT5G46790; | 100.0 | |
| 3oqu_A | 205 | Abscisic acid receptor PYL9; RCAR1, hormone recept | 100.0 | |
| 3k3k_A | 211 | Abscisic acid receptor PYR1; ABA receptor, plant h | 100.0 | |
| 3qrz_A | 223 | Abscisic acid receptor PYL5; crystal, hormone rece | 100.0 | |
| 3f08_A | 146 | Uncharacterized protein Q6HG14; NESG Q6HG14_bachk | 99.97 | |
| 3p51_A | 160 | Uncharacterized protein; structural genomics, PSI- | 99.97 | |
| 2flh_A | 155 | Cytokinin-specific binding protein; zeatin, pathog | 99.97 | |
| 4a8u_A | 159 | Major pollen allergen BET V 1-J; PR-10 protein; 1. | 99.96 | |
| 2vjg_A | 154 | Major allergen DAU C 1; major carrot allergen, pat | 99.96 | |
| 1tw0_A | 157 | Pathogenesis-related class 10 protein SPE-16; seve | 99.96 | |
| 1icx_A | 155 | Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, | 99.96 | |
| 1e09_A | 159 | PRU AV 1; allergen, major cherry allergen, pathoge | 99.96 | |
| 3ie5_A | 165 | Phenolic oxidative coupling protein HYP-1; hyperic | 99.96 | |
| 2qim_A | 158 | PR10.2B; trans-zeatin, cytokinin, plant hormones, | 99.96 | |
| 2i9y_A | 166 | Major latex protein-like protein 28 or MLP-like pr | 99.96 | |
| 3rws_A | 168 | MTN13 protein; zeatin, cytokinin, hormone, lucerne | 99.96 | |
| 2vq5_A | 201 | S-norcoclaurine synthase; lyase, S- norcoclaurine | 99.95 | |
| 2wql_A | 154 | Major allergen DAU C 1; pathogenesis-related prote | 99.94 | |
| 2le1_A | 151 | Uncharacterized protein; structural genomics, nort | 99.93 | |
| 3tvq_A | 169 | Multifunctional cyclase-dehydratase-3-O-methyl TR | 99.61 | |
| 1vjh_A | 122 | BET V I allergen family; structural genomics, cent | 99.6 | |
| 3tl1_A | 159 | WHIE ORF VI, polyketide cyclase; helix-GRIP fold, | 99.59 | |
| 3ijt_A | 155 | SMU.440, putative uncharacterized protein; hypothe | 99.58 | |
| 3tfz_A | 172 | Cyclase; helix-GRIP, BET V1-like superfamily, bios | 99.58 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 99.54 | |
| 3ggn_A | 155 | Uncharacterized protein DR_A0006; structural genom | 99.22 | |
| 1t17_A | 148 | Conserved hypothetical protein; beta-alpha-beta-BE | 99.22 | |
| 2pcs_A | 162 | Conserved protein; structural genomics, unknown fu | 99.04 | |
| 2ns9_A | 157 | Hypothetical protein APE2225; uncharacterized cons | 98.97 | |
| 2leq_A | 146 | Uncharacterized protein; start domains, structural | 98.94 | |
| 1z94_A | 147 | Conserved hypothetical protein; NESG, CV1439, stru | 98.87 | |
| 1xuv_A | 178 | Hypothetical protein MM0500; alpha-beta protein, n | 98.86 | |
| 3p9v_A | 161 | Uncharacterized protein; structural genomics, PSI- | 98.81 | |
| 1xn6_A | 143 | Hypothetical protein BC4709; structural genomics, | 98.8 | |
| 2lak_A | 160 | AHSA1-like protein RHE_CH02687; NESG, structural g | 98.72 | |
| 2il5_A | 171 | Hypothetical protein; structural genomics, APC2365 | 98.72 | |
| 2lcg_A | 142 | Uncharacterized protein; start domain, structural | 98.66 | |
| 1xfs_A | 178 | NC_840354, conserved hypothetical protein; structu | 98.59 | |
| 2ldk_A | 172 | Uncharacterized protein; structural genomics, nort | 98.57 | |
| 3q6a_A | 135 | Uncharacterized protein; structural genomics, PSI- | 98.53 | |
| 3pu2_A | 164 | Uncharacterized protein; SRPBCC superfamily, PSI-b | 98.53 | |
| 1xn5_A | 146 | BH1534 unknown conserved protein; structural genom | 98.51 | |
| 2lgh_A | 144 | Uncharacterized protein; AHSA1, start domain, COG3 | 98.47 | |
| 2l8o_A | 144 | Uncharacterized protein; mixed alpha-beta protein, | 98.44 | |
| 2lf2_A | 175 | Uncharacterized protein; NESG, structural genomics | 98.43 | |
| 2l9p_A | 164 | Uncharacterized protein; structural genomics, nort | 98.42 | |
| 3q64_A | 162 | MLL3774 protein; structural genomics, PSI-biology, | 98.4 | |
| 3q63_A | 151 | MLL2253 protein; structural genomics, PSI-biology, | 98.36 | |
| 3eli_A | 152 | AHSA1, AHA1 domain protein; alpha-beta protein, st | 98.28 | |
| 3rd6_A | 161 | MLL3558 protein; structural genomics, PSI-biology, | 98.27 | |
| 2qpv_A | 156 | Uncharacterized protein ATU1531; structural genomi | 98.25 | |
| 2kew_A | 152 | Uncharacterized protein YNDB; start domain, resona | 98.24 | |
| 3put_A | 166 | Hypothetical conserved protein; structural genomic | 98.22 | |
| 2k5g_A | 191 | Uncharacterized protein; structural genomiccs, pro | 98.14 | |
| 2nn5_A | 184 | Hypothetical protein EF_2215; structural genomics, | 97.96 | |
| 3uid_A | 168 | Putative uncharacterized protein; SRPBCC superfami | 97.96 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 97.85 | |
| 4fpw_A | 181 | CALU16; structural genomics, PSI-biology, northeas | 97.76 | |
| 1zxf_A | 155 | CALC; SELF-sacrificing resistance protein, structu | 97.73 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 97.53 | |
| 3ni8_A | 158 | PFC0360W protein; heat shock, malaria, ATPase, str | 97.49 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 97.41 | |
| 1x53_A | 145 | Activator of 90 kDa heat shock protein ATPase homo | 97.37 | |
| 2luz_A | 192 | CALU16; structural genomics, northeast structural | 97.11 | |
| 2ffs_A | 157 | Hypothetical protein PA1206; 7-stranded beta sheet | 96.76 | |
| 2lio_A | 136 | Uncharacterized protein; structural genomics, nort | 96.27 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 95.93 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 95.67 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 94.79 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 94.45 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 94.06 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 92.41 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 83.61 |
| >3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-49 Score=326.54 Aligned_cols=164 Identities=50% Similarity=0.842 Sum_probs=151.9
Q ss_pred CCCCCcccccccCCCCCCceeEEEEEEEcCChHHHHHHHhCCCCCccccccceEEEEec-CCCC----CCeEEEEEEecC
Q 038201 31 FPVPETLPFYHKHTVGPNQCCSYAVQTINAPLPAVWSVVRRFDNPQAYKHFLKSCHVIN-GDGH----VGTLREVHVISG 105 (201)
Q Consensus 31 ~~~~~~~~~~~~~~~~~~~~~s~v~~~I~ApadkVW~vv~dF~~pk~~p~~V~s~e~~e-Gdg~----vGsvR~vt~~~G 105 (201)
..||+.|++||+|.++++||+|.+.++|+||+++||++|+||++|+.|+|+|++|++++ |||+ +|+||.|+|.+|
T Consensus 11 ~~~~~~~~~~~~~~~~~~~c~s~~~~~I~Ap~d~VWalVrdF~~p~~w~p~V~s~~~~e~Gdg~~~~~vGsVR~ltl~~G 90 (189)
T 3oji_A 11 STLDSIIRTHHTFPRSPNTCTSLIAHRVDAPAHAIWRFVRDFANPNKYKHFIKSCTIRVNGNGIKEIKVGTIREVSVVSG 90 (189)
T ss_dssp HHHHHHHHHHSCCCCC-CEEEEEEEEEESSCHHHHHHHHSCTTCGGGTCTTEEEEEECCC----CCCSTTCEEEEEECSS
T ss_pred HHhHHHHHHhcccCCCCCccceeEEEEEcCCHHHHHHHHhCCCChhhCccccceEEEEecCCCCccCCCCcEEEEEecCC
Confidence 46789999999999999999999999999999999999999999999999999999988 9876 999999999999
Q ss_pred CCcceeEEEEeeecCCCcEEEEEEEecccCCCCeeEEEEEEeecC---C----CceEEEEEEEeeCCCCCCHHHHHHHHH
Q 038201 106 LPAANSTERLEILDDEHHVLSFSVIGGDHRLNNYRSVTTLHASPC---G----TGTVVVESYVCDVPPGNTREETCTFVD 178 (201)
Q Consensus 106 ~p~~~v~ERL~~lDde~~~~sY~vveg~~~~~~Y~ati~v~p~~~---~----~~T~v~Ws~~~d~p~g~~~e~~~~~v~ 178 (201)
.|..+++|||+++|+++|+|+|+|++|++++++|+|+++|+|.+. + ++|++.|+|.+|+|+|+++|+++.|++
T Consensus 91 ~P~~~i~ErL~~lDde~~~~sY~Iieg~~pv~nY~StitV~~~~~~~~G~~~~~~T~v~es~~~D~P~g~t~e~~~~~v~ 170 (189)
T 3oji_A 91 LPASTSVEILEVLDEEKRILSFRVLGGEHRLNNYRSVTSVNEFVVLEKDKKKRVYSVVLESYIVDIPQGNTEEDTRMFVD 170 (189)
T ss_dssp SSBSEEEEEEEEEETTTTEEEEEEEECSBSSCSCEEEEEEEEEEEECTTSCEEEEEEEEEEEEEECCTTSCHHHHHHHHH
T ss_pred CcCceEEEEEEEEeccCCEEEEEEEecCCccccEEEEEEEEeccccCCCccccCcEEEEEeEecCCCCCCCHHHHHHHHH
Confidence 998899999999999999999999999999999999999999753 2 369999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHH
Q 038201 179 TIVRCNLQSLAQISEN 194 (201)
Q Consensus 179 ~i~~~~L~~La~~~e~ 194 (201)
++|++||++|++++|+
T Consensus 171 ~v~~~gL~~L~~~~e~ 186 (189)
T 3oji_A 171 TVVKSNLQNLAVISTA 186 (189)
T ss_dssp HHHHHHHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHhhc
Confidence 9999999999999986
|
| >3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C | Back alignment and structure |
|---|
| >3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* | Back alignment and structure |
|---|
| >3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* | Back alignment and structure |
|---|
| >3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A | Back alignment and structure |
|---|
| >3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} | Back alignment and structure |
|---|
| >2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* | Back alignment and structure |
|---|
| >4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A | Back alignment and structure |
|---|
| >1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* | Back alignment and structure |
|---|
| >1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A | Back alignment and structure |
|---|
| >1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A | Back alignment and structure |
|---|
| >3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 | Back alignment and structure |
|---|
| >2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A | Back alignment and structure |
|---|
| >2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* | Back alignment and structure |
|---|
| >2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A | Back alignment and structure |
|---|
| >2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} | Back alignment and structure |
|---|
| >3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A | Back alignment and structure |
|---|
| >1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A | Back alignment and structure |
|---|
| >3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A | Back alignment and structure |
|---|
| >3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A | Back alignment and structure |
|---|
| >3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A | Back alignment and structure |
|---|
| >1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} | Back alignment and structure |
|---|
| >2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} | Back alignment and structure |
|---|
| >1xfs_A NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, ALP protein, PSI; 1.70A {Nitrosomonas europaea} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2ldk_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3pu2_A Uncharacterized protein; SRPBCC superfamily, PSI-biology, NESG, RHR263, structural GE protein structure initiative; HET: MSE; 2.61A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1xn5_A BH1534 unknown conserved protein; structural genomics, protein structure initiative, PSI, BACI halodurans protein BH1534, alpha + beta; NMR {Bacillus halodurans} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2lgh_A Uncharacterized protein; AHSA1, start domain, COG3832, PF08327, HSP90, heat shock, ST genomics, PSI-biology; NMR {Aeromonas hydrophila subsp} | Back alignment and structure |
|---|
| >2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2lf2_A Uncharacterized protein; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2l9p_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3q63_A MLL2253 protein; structural genomics, PSI-biology, protein structure initiati alpha-beta protein, unknown, structure genomics; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3eli_A AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 | Back alignment and structure |
|---|
| >2kew_A Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown FU PSI-2; NMR {Bacillus subtilis subsp} PDB: 2kte_A | Back alignment and structure |
|---|
| >3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* | Back alignment and structure |
|---|
| >2k5g_A Uncharacterized protein; structural genomiccs, protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2nn5_A Hypothetical protein EF_2215; structural genomics, APC29336, PSI-2, structure initiative; HET: MSE; 1.45A {Enterococcus faecalis} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >4fpw_A CALU16; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.50A {Micromonospora echinospora} PDB: 2luz_A | Back alignment and structure |
|---|
| >1zxf_A CALC; SELF-sacrificing resistance protein, structural genomics, PSI, protein structure initiative; NMR {Micromonospora echinospora} SCOP: d.129.3.5 PDB: 2gkc_A* 2gkd_A 2l65_A* | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >3ni8_A PFC0360W protein; heat shock, malaria, ATPase, structural genomics consortium, unknown function; 2.50A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1x53_A Activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, HSP90,DUF704, C-terminal domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2luz_A CALU16; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2ffs_A Hypothetical protein PA1206; 7-stranded beta sheet, C-terminal helix, structural genomics protein structure initiative; HET: MSE; 2.50A {Pseudomonas aeruginosa} SCOP: d.129.3.7 | Back alignment and structure |
|---|
| >2lio_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 201 | ||||
| d1fm4a_ | 159 | d.129.3.1 (A:) Major tree pollen allergen {Europea | 1e-23 | |
| d1e09a_ | 159 | d.129.3.1 (A:) Major tree pollen allergen {Sweet c | 1e-22 | |
| d2bk0a1 | 153 | d.129.3.1 (A:2-154) Major allergen api g 1 {Celery | 1e-21 | |
| d3cnwa1 | 138 | d.129.3.8 (A:3-140) Uncharacterized protein XoxI { | 2e-21 | |
| d1xdfa1 | 157 | d.129.3.1 (A:1-157) Plant pathogenesis-related pro | 3e-19 | |
| d1txca1 | 147 | d.129.3.1 (A:1-147) Plant pathogenesis-related pro | 1e-17 | |
| d1icxa_ | 155 | d.129.3.1 (A:) Plant pathogenesis-related protein | 2e-17 | |
| d2rera1 | 155 | d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, c | 6e-06 | |
| d1vjha_ | 120 | d.129.3.1 (A:) Hypothetical protein At1G24000 {Tha | 7e-05 | |
| d2d4ra1 | 146 | d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 | 0.002 |
| >d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Length = 159 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: Pathogenesis-related protein 10 (PR10)-like domain: Major tree pollen allergen species: European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]
Score = 90.0 bits (223), Expect = 1e-23
Identities = 21/121 (17%), Positives = 46/121 (38%), Gaps = 5/121 (4%)
Query: 57 TINAPLPAVWSV-VRRFDN--PQAYKHFLKSCHVINGDGHVGTLREVHVISGLPAANSTE 113
T P ++ + D P+ + S I G+G GT+++++ G P +
Sbjct: 10 TSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKD 69
Query: 114 RLEILDDEHHVLSFSVIGGDHRLNNYRSVT-TLHASPCG-TGTVVVESYVCDVPPGNTRE 171
R++ +D + ++SVI G + ++ + G V+ S + +
Sbjct: 70 RVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVK 129
Query: 172 E 172
Sbjct: 130 A 130
|
| >d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Length = 159 | Back information, alignment and structure |
|---|
| >d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Length = 153 | Back information, alignment and structure |
|---|
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Length = 138 | Back information, alignment and structure |
|---|
| >d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 157 | Back information, alignment and structure |
|---|
| >d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Length = 147 | Back information, alignment and structure |
|---|
| >d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 155 | Back information, alignment and structure |
|---|
| >d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Length = 155 | Back information, alignment and structure |
|---|
| >d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 120 | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Length = 146 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| d3cnwa1 | 138 | Uncharacterized protein XoxI {Bacillus cereus [Tax | 99.96 | |
| d1txca1 | 147 | Plant pathogenesis-related protein PR10 {Jicama (P | 99.94 | |
| d1e09a_ | 159 | Major tree pollen allergen {Sweet cherry (Prunus a | 99.94 | |
| d1fm4a_ | 159 | Major tree pollen allergen {European white birch ( | 99.94 | |
| d2bk0a1 | 153 | Major allergen api g 1 {Celery (Apium graveolens) | 99.93 | |
| d1xdfa1 | 157 | Plant pathogenesis-related protein PR10 {Yellow lu | 99.92 | |
| d1icxa_ | 155 | Plant pathogenesis-related protein PR10 {Yellow lu | 99.92 | |
| d1vjha_ | 120 | Hypothetical protein At1G24000 {Thale cress (Arabi | 99.59 | |
| d2rera1 | 155 | Multifunctional enzyme TcmN, cyclase/aromatase dom | 99.54 | |
| d2b79a1 | 137 | Hypothetical protein SMU440 {Streptococcus mutans | 99.49 | |
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 99.43 | |
| d2qpva1 | 133 | Uncharacterized protein Atu1531 {Agrobacterium tum | 99.14 | |
| d2ns9a1 | 147 | Hypothetical protein APE2225 {Aeropyrum pernix [Ta | 99.12 | |
| d1xuva_ | 163 | Hypothetical protein MM0500 {Methanosarcina mazei | 98.97 | |
| d1t17a_ | 148 | Hypothetical protein CC1736 {Caulobacter crescentu | 98.78 | |
| d2pcsa1 | 147 | Hypothetical protein GKP20 {Geobacillus kaustophil | 98.55 | |
| d2il5a1 | 164 | Hypothetical protein SA2116 {Staphylococcus aureus | 98.52 | |
| d1xfsa_ | 165 | Hypothetical protein NE0264 {Nitrosomonas europaea | 98.22 | |
| d1z94a1 | 143 | Hypothetical protein CV1439 {Chromobacterium viola | 98.16 | |
| d3elia1 | 143 | Uncharacterized protein SPO3351 {Silicibacter pome | 97.79 | |
| d1zxfa1 | 155 | Calicheamicin gene cluster protein CalC {Micromono | 97.76 | |
| d1xn5a_ | 138 | Hypothetical protein BH1534 {Bacillus halodurans [ | 97.7 | |
| d1xn6a_ | 143 | Hypothetical protein BC4709 {Bacillus cereus [TaxI | 97.61 | |
| d2nn5a1 | 160 | Hypothetical protein EF2215 {Enterococcus faecalis | 97.44 | |
| d2k5ga1 | 183 | Uncharacterized protein BPP1335 {Bordetella parape | 97.29 | |
| d2ffsa1 | 151 | Hypothetical protein PA1206 {Pseudomonas aeruginos | 96.7 | |
| d1x53a1 | 132 | Activator of 90 kda heat shock protein ATPase homo | 96.67 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 96.59 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 96.25 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 95.4 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 91.85 |
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: Atu1531-like domain: Uncharacterized protein XoxI species: Bacillus cereus [TaxId: 1396]
Probab=99.96 E-value=1e-27 Score=184.03 Aligned_cols=134 Identities=21% Similarity=0.354 Sum_probs=120.6
Q ss_pred eEEEEEEEcCChHHHHHHHhCCCC-CccccccceEEEEecCCCCCCeEEEEEEecCCCcceeEEEEeeecCCCcEEEEEE
Q 038201 51 CSYAVQTINAPLPAVWSVVRRFDN-PQAYKHFLKSCHVINGDGHVGTLREVHVISGLPAANSTERLEILDDEHHVLSFSV 129 (201)
Q Consensus 51 ~s~v~~~I~ApadkVW~vv~dF~~-pk~~p~~V~s~e~~eGdg~vGsvR~vt~~~G~p~~~v~ERL~~lDde~~~~sY~v 129 (201)
++..+++|+||+++||++++||++ |+ |.|.|++|+..+| |++|.+++.+| ..+.|||+.+|+++|+++|++
T Consensus 3 ~~~~si~I~A~pe~VW~~v~df~~~~~-W~p~v~~~~~~~~----G~~R~~~~~~g---~~~~E~l~~~d~~~~~~~y~~ 74 (138)
T d3cnwa1 3 HTTTSMEIFGSPEQVWQLIGGFNSLPD-WLPYIPSSKLTEG----GRVRHLANPDG---DTIIERLEVFNDKERYYTYSI 74 (138)
T ss_dssp EEEEEEEESSCHHHHHHHHCCTTCGGG-TCTTCSEEEEEGG----GTEEEEECTTC---CEEEEEEEEEETTTTEEEEEE
T ss_pred cEEEEEEEeCCHHHHHHHHhCccchHH-HhcccceeEeecC----ceeEEEEecCC---ceeEEEEEEEeCCCcEEEEEE
Confidence 467789999999999999999999 66 5578999987633 89999999887 688999999999999999999
Q ss_pred EecccCCCCeeEEEEEEeecCCCceEEEEEEEeeCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q 038201 130 IGGDHRLNNYRSVTTLHASPCGTGTVVVESYVCDVPPGNTREETCTFVDTIVRCNLQSLAQISE 193 (201)
Q Consensus 130 veg~~~~~~Y~ati~v~p~~~~~~T~v~Ws~~~d~p~g~~~e~~~~~v~~i~~~~L~~La~~~e 193 (201)
++|+.++++|.++++|.|.+++++|+|.|++.|+ |++.+++.+..+++++|+++|+.|++.+.
T Consensus 75 ~~~~~p~~~~~~~~~l~p~~~g~~t~v~w~~~f~-p~~~~~~~~~~~~~~~~~~~l~~L~~~f~ 137 (138)
T d3cnwa1 75 MNAPFPVTNYLSTIQVKEGTESNTSLVEWSGTFT-PVEVSDEEAINLFHGIYSDGLKALQQAFL 137 (138)
T ss_dssp EECSSSEEEEEEEEEEEECSSTTCEEEEEEEEEE-ESSSCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred ecCCCcceeeEEEEEEEECCCCCeEEEEEEEEEe-cCCCCHHHHHHHHHHHHHHHHHHHHHhhc
Confidence 9999999999999999998756679999999999 46788888899999999999999999874
|
| >d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} | Back information, alignment and structure |
|---|
| >d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} | Back information, alignment and structure |
|---|
| >d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} | Back information, alignment and structure |
|---|
| >d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} | Back information, alignment and structure |
|---|
| >d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} | Back information, alignment and structure |
|---|
| >d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} | Back information, alignment and structure |
|---|
| >d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} | Back information, alignment and structure |
|---|
| >d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} | Back information, alignment and structure |
|---|
| >d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} | Back information, alignment and structure |
|---|
| >d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2k5ga1 d.129.3.5 (A:1-183) Uncharacterized protein BPP1335 {Bordetella parapertussis [TaxId: 519]} | Back information, alignment and structure |
|---|
| >d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|