Citrus Sinensis ID: 038216


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
AAAADDDNDDVDLFGEETEEDKKAAEERSAAIKASAKRKESGKSSVLLDIKPWNDETDMQKLEEAVRSIKMEGLHWGASKLVPVGYGIKKLQIMLTIVDDLVSVDNLIEEHLMAEPINEYVQSCDIVAFNKI
ccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHccEEEcccEEEccccccccEEEEEEEEEEEEEEEccccHHHHHHHHHHcccccccccEEEEEEEccc
*********DVDLF********************************LLDIKPWNDETDMQKLEEAVRSIKMEGLHWGASKLVPVGYGIKKLQIMLTIVDDLVSVDNLIEEHLMAEPINEYVQSCDIVAFNKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AAAADDDNDDVDLFGEETEEDKKAAEERSAAIKASAKRKESGKSSVLLDIKPWNDETDMQKLEEAVRSIKMEGLHWGASKLVPVGYGIKKLQIMLTIVDDLVSVDNLIEEHLMAEPINEYVQSCDIVAFNKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor 1-beta 1 EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.probableQ84WM9
Elongation factor 1-beta EF-1-beta and EF-1-beta' stimulate the exchange of GDP bound to EF-1-alpha to GTP.probableP29545

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B64, chain A
Confidence level:very confident
Coverage over the Query: 40-132
View the alignment between query and template
View the model in PyMOL