Citrus Sinensis ID: 038222

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MQSLPTSTVDPDCFILWLVITLVWVKALSFISRGSLKQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDTNQDLQRKKSK
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHcccEEEcHHHHHHHHHHHccccccccccHHHHHHHHccccccEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEcccEcHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccEEccccccHHHHHHHEccccEEEccccHHHHHHHHHHHHHHHcHHHHHccHHHHHHHcc
mqslptstvdpdcFILWLVITLVWVKALSFIsrgslkqlppgprpypvignllelgdkphKSLLELAKIHGPIMSLKLASMVKTILLdhdssfcnrtvphamsshehrefslawmpvsrpwkNIRKICNMLIFTTqkldtnqdlqrkksk
mqslptstvdpdcFILWLVITLVWVKALSFISrgslkqlppgpRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTtqkldtnqdlqrkksk
MQSLPTSTVDPDCFILWLVITLVWVKALSFISRGSLKQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDTNQDLQRKKSK
*********DPDCFILWLVITLVWVKALSFISRGSLKQLP*GPRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQK*************
******S*VDPDCFILWLVITLVWVKAL****************PYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDTNQDLQRKK**
********VDPDCFILWLVITLVWVKALSFISRGSLKQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDT**********
**SLPTSTVDPDCFILWLVITLVWVKALSFISRGSLKQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDTNQDLQ*****
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSLPTSTVDPDCFILWLVITLVWVKALSFISRGSLKQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDTNQDLQRKKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q8VWZ7 493 Geraniol 8-hydroxylase OS N/A no 0.886 0.269 0.451 2e-29
D1MI46 495 Geraniol 8-hydroxylase OS N/A no 0.88 0.266 0.426 5e-22
O23976 490 7-ethoxycoumarin O-deethy N/A no 0.853 0.261 0.391 6e-21
O64899 487 (S)-N-methylcoclaurine 3' N/A no 0.746 0.229 0.368 6e-20
O64900 488 (S)-N-methylcoclaurine 3' N/A no 0.8 0.245 0.374 7e-20
Q9FXW4 488 Probable (S)-N-methylcocl N/A no 0.76 0.233 0.370 2e-19
O64635 511 Cytochrome P450 76C4 OS=A no no 0.9 0.264 0.342 4e-17
O64636 512 Cytochrome P450 76C1 OS=A no no 0.906 0.265 0.335 8e-17
P37122 505 Cytochrome P450 76A2 OS=S N/A no 0.9 0.267 0.304 7e-16
P58050 496 Cytochrome P450 71B13 OS= no no 0.886 0.268 0.308 6e-15
>sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 11/144 (7%)

Query: 15  ILWLVITLVWVKALSFISRGSLKQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIM 74
           IL L+  L   +A S++SR + K LPPGP P P IG+L  LGD+PHKSL +L+K HGPIM
Sbjct: 7   ILTLLFALTLYEAFSYLSRRT-KNLPPGPSPLPFIGSLHLLGDQPHKSLAKLSKKHGPIM 65

Query: 75  SLKLA----------SMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNI 124
           SLKL           +M K +L   D +F +R+VP+A+ +H   +FS+ W+PV+  W+++
Sbjct: 66  SLKLGQITTIVISSSTMAKEVLQKQDLAFSSRSVPNALHAHNQFKFSVVWLPVASRWRSL 125

Query: 125 RKICNMLIFTTQKLDTNQDLQRKK 148
           RK+ N  IF+  +LD NQ L+ +K
Sbjct: 126 RKVLNSNIFSGNRLDANQHLRTRK 149
Hydroxylase involved in the biosynthesis of hydroxygeraniol, a precursor of the terpenoid indole alkaloids such as vinblastine and vincristine. Also able to hydroxylate in vitro nerol and to catalyze 3'-hydroxylation of the flavanone naringenin to form eriodictyol. No activity with apigenin, kaempferol, p-coumaric acid and ferulic acid as substrates.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 5EC: 2
>sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 Back     alignment and function description
>sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 Back     alignment and function description
>sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 Back     alignment and function description
>sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 Back     alignment and function description
>sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
255537171 377 cytochrome P450, putative [Ricinus commu 0.906 0.360 0.52 4e-36
224058639 493 cytochrome P450 [Populus trichocarpa] gi 0.86 0.261 0.5 8e-36
224071632 496 cytochrome P450 [Populus trichocarpa] gi 0.893 0.270 0.510 2e-35
297742026 594 unnamed protein product [Vitis vinifera] 0.9 0.227 0.462 2e-31
225427085 498 PREDICTED: cytochrome P450 76C4 [Vitis v 0.9 0.271 0.462 3e-31
359474275 499 PREDICTED: 7-ethoxycoumarin O-deethylase 0.873 0.262 0.486 2e-30
356574422 522 PREDICTED: cytochrome P450 76C4-like [Gl 0.88 0.252 0.493 5e-30
356575857 501 PREDICTED: cytochrome P450 76C4-like [Gl 0.88 0.263 0.493 5e-30
356577942 500 PREDICTED: cytochrome P450 76C1-like, pa 0.9 0.27 0.476 1e-29
356534205 309 PREDICTED: LOW QUALITY PROTEIN: 7-ethoxy 0.793 0.385 0.503 5e-29
>gi|255537171|ref|XP_002509652.1| cytochrome P450, putative [Ricinus communis] gi|223549551|gb|EEF51039.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 102/150 (68%), Gaps = 14/150 (9%)

Query: 12  DCFILWLVITLVWVKALSFISRGS---LKQLPPGPRPYPVIGNLLELGDKPHKSLLELAK 68
           D  I++L++ L +  AL F+ +GS     +LPPGP P P+IGNL +LGDKPH+SL +LAK
Sbjct: 2   DLLIVFLLV-LAFAHALKFVVKGSKTTRGKLPPGPSPLPIIGNLFDLGDKPHRSLAKLAK 60

Query: 69  IHGPIMSLKLA----------SMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVS 118
           IHGP+MSLKL           S+ K +L  HD SF NRTV  A+ + +H E S+ W+PV 
Sbjct: 61  IHGPLMSLKLGQITTVVISSSSLAKEVLQKHDLSFSNRTVVQAIQALDHHEASMPWLPVG 120

Query: 119 RPWKNIRKICNMLIFTTQKLDTNQDLQRKK 148
            PW+N+RKIC+  IFT QKLD NQDL+ KK
Sbjct: 121 APWRNLRKICSFYIFTNQKLDANQDLRCKK 150

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224058639|ref|XP_002299579.1| cytochrome P450 [Populus trichocarpa] gi|222846837|gb|EEE84384.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224071632|ref|XP_002303546.1| cytochrome P450 [Populus trichocarpa] gi|222840978|gb|EEE78525.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297742026|emb|CBI33813.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225427085|ref|XP_002276561.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474275|ref|XP_003631427.1| PREDICTED: 7-ethoxycoumarin O-deethylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356574422|ref|XP_003555347.1| PREDICTED: cytochrome P450 76C4-like [Glycine max] Back     alignment and taxonomy information
>gi|356575857|ref|XP_003556053.1| PREDICTED: cytochrome P450 76C4-like [Glycine max] Back     alignment and taxonomy information
>gi|356577942|ref|XP_003557080.1| PREDICTED: cytochrome P450 76C1-like, partial [Glycine max] Back     alignment and taxonomy information
>gi|356534205|ref|XP_003535648.1| PREDICTED: LOW QUALITY PROTEIN: 7-ethoxycoumarin O-deethylase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
UNIPROTKB|Q8VWZ7 493 CYP76B6 "Geraniol 8-hydroxylas 0.886 0.269 0.451 7.9e-28
UNIPROTKB|D1MI46 495 CYP76B10 "Geraniol 8-hydroxyla 0.86 0.260 0.435 1.9e-26
TAIR|locus:2043694 511 CYP76C4 ""cytochrome P450, fam 0.9 0.264 0.369 1.3e-16
TAIR|locus:2043699 512 CYP76C1 ""cytochrome P450, fam 0.906 0.265 0.335 1.7e-16
TAIR|locus:2012693 511 CYP76C6 ""cytochrome P450, fam 0.893 0.262 0.346 7.6e-16
TAIR|locus:2043614 515 CYP76C3 ""cytochrome P450, fam 0.886 0.258 0.331 7.7e-16
TAIR|locus:2139084 516 CYP706A4 ""cytochrome P450, fa 0.953 0.277 0.305 5.7e-15
TAIR|locus:2179280 496 CYP71B12 ""cytochrome P450, fa 0.866 0.262 0.308 1.4e-14
TAIR|locus:2139099 520 CYP706A5 ""cytochrome P450, fa 0.873 0.251 0.319 2e-14
TAIR|locus:2179290 496 CYP71B13 ""cytochrome P450, fa 0.866 0.262 0.328 2.3e-14
UNIPROTKB|Q8VWZ7 CYP76B6 "Geraniol 8-hydroxylase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
 Score = 314 (115.6 bits), Expect = 7.9e-28, P = 7.9e-28
 Identities = 65/144 (45%), Positives = 95/144 (65%)

Query:    15 ILWLVITLVWVKALSFISRGSLKQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIM 74
             IL L+  L   +A S++SR + K LPPGP P P IG+L  LGD+PHKSL +L+K HGPIM
Sbjct:     7 ILTLLFALTLYEAFSYLSRRT-KNLPPGPSPLPFIGSLHLLGDQPHKSLAKLSKKHGPIM 65

Query:    75 SLKL----------ASMVKTILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNI 124
             SLKL          ++M K +L   D +F +R+VP+A+ +H   +FS+ W+PV+  W+++
Sbjct:    66 SLKLGQITTIVISSSTMAKEVLQKQDLAFSSRSVPNALHAHNQFKFSVVWLPVASRWRSL 125

Query:   125 RKICNMLIFTTQKLDTNQDLQRKK 148
             RK+ N  IF+  +LD NQ L+ +K
Sbjct:   126 RKVLNSNIFSGNRLDANQHLRTRK 149
GO:0016099 "monoterpenoid biosynthetic process" evidence=IDA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
UNIPROTKB|D1MI46 CYP76B10 "Geraniol 8-hydroxylase" [Swertia mussotii (taxid:137888)] Back     alignment and assigned GO terms
TAIR|locus:2043694 CYP76C4 ""cytochrome P450, family 76, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012693 CYP76C6 ""cytochrome P450, family 76, subfamily C, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139084 CYP706A4 ""cytochrome P450, family 706, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179280 CYP71B12 ""cytochrome P450, family 71, subfamily B, polypeptide 12"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139099 CYP706A5 ""cytochrome P450, family 706, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179290 CYP71B13 ""cytochrome P450, family 71, subfamily B, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP76F4
cytochrome P450 (505 aa)
(Populus trichocarpa)
Predicted Functional Partners:
CYP715A2-2
cytochrome P450 (359 aa)
  •     0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-21
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 8e-17
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-13
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-11
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 5e-10
pfam00067 461 pfam00067, p450, Cytochrome P450 1e-09
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 2e-07
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-07
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-06
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 3e-06
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score = 87.9 bits (218), Expect = 3e-21
 Identities = 53/145 (36%), Positives = 75/145 (51%), Gaps = 19/145 (13%)

Query: 11  PDCFILWLVITLVWVKALSFISRGSLKQ---LPPGPRPYPVIGNLLELGDKPHKSLLELA 67
           P   +L  V   V V  L     GS K    LPPGPR +PV+GNL +LG KPH ++  LA
Sbjct: 4   PLPLLLGTVAVSVLVWCLLLRRGGSGKHKRPLPPGPRGWPVLGNLPQLGPKPHHTMAALA 63

Query: 68  KIHGPIMSLKL----------ASMVKTILLDHDSSFCNRTVPHAMSSHEHREFS---LAW 114
           K +GP+  L+           AS+    L  HD++F NR  P+  S  EH  ++   L +
Sbjct: 64  KTYGPLFRLRFGFVDVVVAASASVAAQFLRTHDANFSNRP-PN--SGAEHMAYNYQDLVF 120

Query: 115 MPVSRPWKNIRKICNMLIFTTQKLD 139
            P    W+ +RKIC + +F+ + LD
Sbjct: 121 APYGPRWRALRKICAVHLFSAKALD 145

Length = 517
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.92
PLN02687 517 flavonoid 3'-monooxygenase 99.86
PLN02183 516 ferulate 5-hydroxylase 99.82
PLN03112 514 cytochrome P450 family protein; Provisional 99.82
PLN02394 503 trans-cinnamate 4-monooxygenase 99.81
PLN03234 499 cytochrome P450 83B1; Provisional 99.8
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.8
PLN02971 543 tryptophan N-hydroxylase 99.79
PLN00168 519 Cytochrome P450; Provisional 99.79
PTZ00404 482 cytochrome P450; Provisional 99.77
PLN02196 463 abscisic acid 8'-hydroxylase 99.74
PLN02966 502 cytochrome P450 83A1 99.74
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.73
PLN02290 516 cytokinin trans-hydroxylase 99.72
PLN02774 463 brassinosteroid-6-oxidase 99.72
PLN02500 490 cytochrome P450 90B1 99.72
PLN02655 466 ent-kaurene oxidase 99.72
PLN03018 534 homomethionine N-hydroxylase 99.67
PLN02302 490 ent-kaurenoic acid oxidase 99.65
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.62
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.6
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.59
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.58
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.52
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.5
PLN02936 489 epsilon-ring hydroxylase 99.39
PLN02738 633 carotene beta-ring hydroxylase 99.31
PLN02648 480 allene oxide synthase 99.21
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.1
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.06
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.01
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 97.89
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.92  E-value=3.5e-24  Score=160.28  Aligned_cols=114  Identities=26%  Similarity=0.554  Sum_probs=101.8

Q ss_pred             CCCCCCCCCCCccccccccCCCC-cHHHHHHHHHHhCCceEechH----------HHHHHHHhhCCCCccCCCc-ccccc
Q 038222           36 LKQLPPGPRPYPVIGNLLELGDK-PHKSLLELAKIHGPIMSLKLA----------SMVKTILLDHDSSFCNRTV-PHAMS  103 (150)
Q Consensus        36 ~~~~~pgp~~~p~~G~~~~~~~~-~~~~~~~~~~~yG~v~~~~~~----------~~~~~il~~~~~~f~~r~~-~~~~~  103 (150)
                      +.++||||+++|++||++++... ++..+.+|+++|||++++++|          ++++|++++++..|++||. .....
T Consensus        24 ~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   24 RRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            37889999999999999999766 899999999999999999998          9999999999999999997 22445


Q ss_pred             ccccCcceeeecCCCcchHHHHHHhHhhhcChhhhhhhHHHHHhhh
Q 038222          104 SHEHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDTNQDLQRKKS  149 (150)
Q Consensus       104 ~l~~~~~~~~~~~~g~~w~~~Rk~~~~~~f~~~~l~~~~~~~~~~~  149 (150)
                      .+.+++.|++++++|+.||++||++....|+...++.+.....+|+
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~  149 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEV  149 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHH
Confidence            5665788999998999999999999999999999999887776665

>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-09
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-09
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-08
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 6e-08
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-06
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-06
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-06
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-06
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-06
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 3e-06
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 4e-06
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 1e-05
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-04
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-04
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-04
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-04
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-04
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-04
3pm0_A 507 Structural Characterization Of The Complex Between 5e-04
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure 
Iteration: 1

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 13/106 (12%)
Query: 38  QLPPGPRPYPVIGNLLELGDKP-HKSLLELAKIHGPIMSLKLA----------SMVKTIL 86
           +LPPGP P PVIGN+L++G K   KSL  L+K++GP+ +L               VK  L
Sbjct: 11  KLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEAL 70
Query: 87  LDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLI 132
           +D    F  R +   ++   +R F + +    + WK IR+   M +
Sbjct: 71  IDLGEEFSGRGI-FPLAERANRGFGIVFSN-GKKWKEIRRFSLMTL 114
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 7e-21
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 7e-21
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-19
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-18
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-17
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-17
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 8e-17
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-16
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-16
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-15
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-15
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-14
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-14
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-13
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 7e-10
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-09
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-09
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-07
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-05
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 4e-05
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 5e-05
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 5e-05
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score = 86.6 bits (215), Expect = 7e-21
 Identities = 16/117 (13%), Positives = 33/117 (28%), Gaps = 15/117 (12%)

Query: 38  QLPPGPRPYPVIGNLLELG----DKPHKSLLELAKIHGPIMSLKL----------ASMVK 83
              P P     +            K H   ++  + +GPI   KL             V 
Sbjct: 9   NEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVA 68

Query: 84  TILLDHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRP-WKNIRKICNMLIFTTQKLD 139
            +      +     +P  ++ H++ +  +  +      WK  R   N  +   +   
Sbjct: 69  LLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATK 125
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.78
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.77
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.76
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.75
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.74
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.71
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.71
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.7
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.69
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.69
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.69
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.67
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.67
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.67
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.66
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.64
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.62
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.62
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.61
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.6
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.59
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.59
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.5
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.46
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.46
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.39
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.35
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.32
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.31
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.3
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.29
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.27
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.23
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.21
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.2
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.2
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.19
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.17
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.17
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.16
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.15
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.13
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.1
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.09
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.09
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.09
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.07
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.04
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.02
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.02
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.01
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.0
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 98.99
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 98.98
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 98.93
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 98.92
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 98.91
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 98.91
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 98.91
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 98.88
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 98.88
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.87
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 98.85
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 98.85
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 98.82
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.81
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.79
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 98.79
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 98.78
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.76
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.73
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 98.56
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.55
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.54
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.36
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.1
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 94.34
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.78  E-value=1.5e-19  Score=135.04  Aligned_cols=113  Identities=18%  Similarity=0.333  Sum_probs=89.3

Q ss_pred             CCCCCCCCCCCccccccccCC--CCcHHHHHHHHHHhCCceEechH----------HHHHHHHhhCCCCccCCCcccccc
Q 038222           36 LKQLPPGPRPYPVIGNLLELG--DKPHKSLLELAKIHGPIMSLKLA----------SMVKTILLDHDSSFCNRTVPHAMS  103 (150)
Q Consensus        36 ~~~~~pgp~~~p~~G~~~~~~--~~~~~~~~~~~~~yG~v~~~~~~----------~~~~~il~~~~~~f~~r~~~~~~~  103 (150)
                      ..+.||||+++|++||++++.  .+++..+.+|+++||+++++++|          +++++++.+++..|.+|+......
T Consensus         6 ~~~~PPgP~~lPliGnl~~l~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~~~~   85 (494)
T 3swz_A            6 GAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLD   85 (494)
T ss_dssp             ------CCBCCCEEEEESSCTTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCHHHH
T ss_pred             CCCCCCCCCCCCeEcchHHhCCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcHHHH
Confidence            356799999999999999884  35788899999999999999987          999999999999999888665444


Q ss_pred             ccccCcceeeecCCCcchHHHHHHhHhhhcCh--hhhhhhHHHHHhhh
Q 038222          104 SHEHREFSLAWMPVSRPWKNIRKICNMLIFTT--QKLDTNQDLQRKKS  149 (150)
Q Consensus       104 ~l~~~~~~~~~~~~g~~w~~~Rk~~~~~~f~~--~~l~~~~~~~~~~~  149 (150)
                      .+..++.|+++.++|+.|+++||+++ ++|+.  ..++.+.+.+++++
T Consensus        86 ~~~~~~~gl~~~~~g~~wr~~Rr~~~-~~f~~~~~~~~~~~~~i~~~~  132 (494)
T 3swz_A           86 IASNNRKGIAFADSGAHWQLHRRLAM-ATFALFKDGDQKLEKIICQEI  132 (494)
T ss_dssp             HHTTTTCSSSSSCSSHHHHHHHHHHH-HHTTTTSSSTTCHHHHHHHHH
T ss_pred             HhccCCCCeEeCCCCHHHHHHHHHHH-HHHHHhcchHHHHHHHHHHHH
Confidence            44444567777767999999999999 99974  55777888887765
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-17
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-15
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 8e-15
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-13
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-13
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-13
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 0.003
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.4 bits (181), Expect = 5e-17
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 13/107 (12%)

Query: 39  LPPGPRPYPVIGNLLELGDK-PHKSLLELAKIHGPIMSLKL----------ASMVKTILL 87
           LPPGP P PVIGN+L++G K   KSL  L+K++GP+ +L               VK  L+
Sbjct: 4   LPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALI 63

Query: 88  DHDSSFCNRTVPHAMSSHEHREFSLAWMPVSRPWKNIRKICNMLIFT 134
           D    F  R +   ++   +R F + +    + WK IR+   M +  
Sbjct: 64  DLGEEFSGRGIFP-LAERANRGFGIVFSN-GKKWKEIRRFSLMTLRN 108
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.75
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.73
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.64
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.62
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.56
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.52
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.25
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.13
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.06
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.04
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 98.83
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 98.8
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 98.71
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.69
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.67
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.46
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.41
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 98.37
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.28
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 97.58
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 97.32
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.75  E-value=7.4e-19  Score=128.10  Aligned_cols=108  Identities=24%  Similarity=0.323  Sum_probs=86.6

Q ss_pred             CCCCCCCCCCccccccccCCCCcHHHHHHHHHHhCCceEechH----------HHHHHHHhhCCC-CccCCCcccccccc
Q 038222           37 KQLPPGPRPYPVIGNLLELGDKPHKSLLELAKIHGPIMSLKLA----------SMVKTILLDHDS-SFCNRTVPHAMSSH  105 (150)
Q Consensus        37 ~~~~pgp~~~p~~G~~~~~~~~~~~~~~~~~~~yG~v~~~~~~----------~~~~~il~~~~~-~f~~r~~~~~~~~l  105 (150)
                      ++.+|||+++|++||++++..+++.++.+|+++||+|++++++          ++++++|.++.. .+..++..... .+
T Consensus         8 ~~~iPGP~~~P~iG~~~~~~~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~-~~   86 (472)
T d1tqna_           8 KLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPV-GF   86 (472)
T ss_dssp             HTTCCCCCCBTTTBTGGGGGGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCC-GG
T ss_pred             hcCCCCCCCcCceeEHHHhhCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccccc-cc
Confidence            3468999999999999999888999999999999999999986          999999987654 34433322221 22


Q ss_pred             ccCcceeeecCCCcchHHHHHHhHhhhcChhhhhhhHHHHHhhh
Q 038222          106 EHREFSLAWMPVSRPWKNIRKICNMLIFTTQKLDTNQDLQRKKS  149 (150)
Q Consensus       106 ~~~~~~~~~~~~g~~w~~~Rk~~~~~~f~~~~l~~~~~~~~~~~  149 (150)
                      .  +.+ ++..+|+.|+.+|++++ +.|+.+.++.+.+.+++++
T Consensus        87 ~--~~~-i~~~~g~~~~~~R~~~~-~~~~~~~l~~~~~~~~~~~  126 (472)
T d1tqna_          87 M--KSA-ISIAEDEEWKRLRSLLS-PTFTSGKLKEMVPIIAQYG  126 (472)
T ss_dssp             G--GGS-TTTCCHHHHHHHHHHTT-GGGSHHHHHTTHHHHHHHH
T ss_pred             c--CCc-eeccCcHHHHHhhhhcC-ccccchhhhcccchhhhhh
Confidence            2  233 45567999999999999 9999999999999988765
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure