Citrus Sinensis ID: 038359

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110

MDSFRGQGGIQMLLNAEQEAQHIVSSARNLKMARLKQAKDEAEKEVTLYKSHLETEYQKRISETSGSSESTVKRLEEETEIKIKQLKDSALKVSKEVTDLLIKYITTIKN

ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

************LLNAEQEAQHIVSSARNLKMARLKQAKDEAEKEVTLYKSHLETE**********************************LKVSKEVTDLLIKYITTIKN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDSFRGQGGIQMLLNAEQEAQHIVSSARNLKxxxxxxxxxxxxxxxxxxxxxLETEYQKRISETSGSSESTVKRLEEETEIKIKQLKDSALKVSKEVTDLLIKYITTIKN

Annotation	Function Description	Confidence Level	Reference Protein
V-type proton ATPase subunit G3	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	probable	Q9SZH0
V-type proton ATPase subunit G	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	probable	Q9XZH6
V-type proton ATPase subunit G	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	probable	Q9SP55

No EC number assigned to the protein, probably not an enzyme!

Template: 4EFA, chain G
Confidence level:very confident
Coverage over the Query: 5-108
View the alignment between query and template
View the model in PyMOL