Citrus Sinensis ID: 038392


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MDKRSQTRPVWKKSGFNSGSGERKWHPGLEPRRLNPDPDPDFAIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGRFVDWSQGCVRNKPLNYSRRDGFIKFSELKLPDSTSSWETTEEPIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQGLKELKNDYFPNYNTKIL
ccccccccccEEEccccccccccccEEEEEcccccccccccEEEEcccEEEEcccccEEEcccccccccccEEEEEcccccEEEEEccccccccEEEEcccccccccccccEEccEEcccccEEEEEcccccccccccEEEEEEcccccEEEEEEccEEEEEEccccccEEEEccccccccEEEEEEEcccEEEEEEEEccccEEEEEEEcccccEEEEEEEEcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHccccccccccccccEEEccccccccEEEEEccccccccHHHHHHHHHEEEEccccc
cccEEccccEEEEcccccccccccEEEEEEEcccccccccEEEEEcccEEEEcccccEEEEccccccccccHHHEEcccccEEEEEccccccccEEEEEcccccccccccccccccccccccHHEEccccccccccccEEEEEccccccEEEEEcccEEEEEccccccEEEcccccccccEEEEEEEEcccEEEEEEEEEcccEEEEEEEcccccEEEEEEEccccccEEEEEEccccccccHHHcccccccccccccccccccccccccccccccccccEEccEccccccccEEEEcccccccccEEEEEEcccccccHHHHHHHccccccHHHHHHHccccccccEEEccccHHHHccccccHHHHHHHHHHHcccccHHHHHHccccccccEcc
mdkrsqtrpvwkksgfnsgsgerkwhpgleprrlnpdpdpdfaiptgnlvltsqNKSVVWSanlskevrtPVVLQLLdsgnlvlrgerdggsetylwqsldypsdtllpgmklgwDLKTGLERRitswkssddpspgdffWKIERQFYPELVMWKGsrkfyrtgpwngiIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWElysnlpkdqcdsyglcgangifiisqspicqclegfltnsgrfvdwsqgcvrnkplnysrrdgfikfselklpdstsswetteepigkvkiktktwsyHCFELATIAIAtdnfstnkklgeggfgpvykgtladgQEIVVKRFSKISEQGLKElkndyfpnyntkil
mdkrsqtrpvwkksgfnsgsgerkwhpglepRRLNPDPDPDFAIPTGNLVLTSQNKSVVWSANlskevrtpvvlQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERritswkssddpspgdfFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSgrfvdwsqgcvrnkplnysrrdGFIKfselklpdstsswetteepigkvkiktktWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISeqglkelkndyfpnyntkil
MDKRSQTRPVWKKSGFNSGSGERKWHPGLEPRRLNPDPDPDFAIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGRFVDWSQGCVRNKPLNYSRRDGFIKFSELKLPDSTSSWETTEEPIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQGLKELKNDYFPNYNTKIL
******************************************AIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRITSW********GDFFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGRFVDWSQGCVRNKPLNYSRRDGFIKFSELKL******W*TTEEPIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQGLKELKNDYF********
***RSQTRPVWKKSGFNSGSGERKWHPGLEPRRLNPDPDPDFAIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGRFVDWSQGCVRNKPLNYSRRDGFIKFSELKLPDSTSSWETTEEPIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQGLKELKNDYFPNYNTKIL
***********************KWHPGLEPRRLNPDPDPDFAIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRIT********SPGDFFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGRFVDWSQGCVRNKPLNYSRRDGFIKFSELKLP***********PIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQGLKELKNDYFPNYNTKIL
*DKRSQTRPVWKKSGFNSGSGERKWHPGLEPRRLNPDPDPDFAIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGRFVDWSQGCVRNKPLNYSRRDGFIKFSELKLPDSTSSWETTEEPIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQGLKELKNDYFPNYNTKIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKRSQTRPVWKKSGFNSGSGERKWHPGLEPRRLNPDPDPDFAIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGRFVDWSQGCVRNKPLNYSRRDGFIKFSELKLPDSTSSWETTEEPIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQGLKELKNDYFPNYNTKIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query397 2.2.26 [Sep-21-2011]
O81905 850 Receptor-like serine/thre yes no 0.664 0.310 0.429 1e-58
O81832 783 G-type lectin S-receptor- no no 0.652 0.330 0.421 8e-55
P07761436 S-locus-specific glycopro N/A no 0.788 0.717 0.370 6e-54
P0DH86 853 G-type lectin S-receptor- no no 0.816 0.379 0.375 5e-53
P17840435 S-locus-specific glycopro N/A no 0.808 0.737 0.365 1e-52
P0DH87546 Putative inactive G-type no no 0.826 0.600 0.373 1e-52
Q09092 857 Putative serine/threonine N/A no 0.788 0.365 0.367 7e-52
P22553435 S-locus-specific glycopro N/A no 0.788 0.719 0.358 2e-50
Q39086 843 Receptor-like serine/thre no no 0.659 0.310 0.386 2e-48
Q9S972 847 Receptor-like serine/thre no no 0.670 0.314 0.386 4e-47
>sp|O81905|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8 OS=Arabidopsis thaliana GN=SD18 PE=1 SV=1 Back     alignment and function desciption
 Score =  227 bits (578), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 116/270 (42%), Positives = 170/270 (62%), Gaps = 6/270 (2%)

Query: 44  IPTGNLVLTSQNKSVVWSANLSK-EVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDY 102
           I   NLV+  Q+ + VWS NL+  +VR+P+V +LLD+GN VLR  ++   +  LWQS D+
Sbjct: 99  ISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDF 158

Query: 103 PSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYR 162
           P+DTLLP MKLGWD KTG  R I SWKS DDPS GDF +K+E + +PE+ +W    + YR
Sbjct: 159 PTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRMYR 218

Query: 163 TGPWNGIIFS-ASSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFI 221
           +GPWNGI FS    ++      ++F ++++E+ Y+F +T   V SR+ ++ +  L QRF 
Sbjct: 219 SGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSS-GLLQRFT 277

Query: 222 WRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGR---FVDWSQ 278
           W +  Q+W  +   PKDQCD Y  CG  G    + SP+C C++GF   + +     D S 
Sbjct: 278 WIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGSD 337

Query: 279 GCVRNKPLNYSRRDGFIKFSELKLPDSTSS 308
           GCVR   L+    DGF++  ++KLPD+T++
Sbjct: 338 GCVRKTLLSCGGGDGFVRLKKMKLPDTTTA 367




Involved in the regulation of cellular expansion and differentiation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O81832|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 OS=Arabidopsis thaliana GN=At4g27290 PE=3 SV=4 Back     alignment and function description
>sp|P07761|SLSG6_BRAOL S-locus-specific glycoprotein S6 OS=Brassica oleracea GN=SLSG PE=2 SV=2 Back     alignment and function description
>sp|P0DH86|SRK_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SRK OS=Arabidopsis thaliana GN=SRK PE=2 SV=1 Back     alignment and function description
>sp|P17840|SLSG3_BRAOL S-locus-specific glycoprotein S13 OS=Brassica oleracea GN=SLSG PE=2 SV=2 Back     alignment and function description
>sp|P0DH87|PSRK_ARATH Putative inactive G-type lectin S-receptor-like serine/threonine-protein kinase SRK OS=Arabidopsis thaliana GN=PSEUDOSRKA PE=5 SV=1 Back     alignment and function description
>sp|Q09092|SRK6_BRAOE Putative serine/threonine-protein kinase receptor OS=Brassica oleracea var. acephala GN=SRK6 PE=2 SV=2 Back     alignment and function description
>sp|P22553|SLSG2_BRAOA S-locus-specific glycoprotein BS29-2 OS=Brassica oleracea var. alboglabra GN=SLSG PE=2 SV=1 Back     alignment and function description
>sp|Q39086|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7 OS=Arabidopsis thaliana GN=SD17 PE=1 SV=1 Back     alignment and function description
>sp|Q9S972|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6 OS=Arabidopsis thaliana GN=SD16 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
224113149 820 predicted protein [Populus trichocarpa] 0.818 0.396 0.517 2e-88
224151394439 predicted protein [Populus trichocarpa] 0.813 0.735 0.505 4e-87
224124250 820 predicted protein [Populus trichocarpa] 0.662 0.320 0.591 6e-87
224126243 836 predicted protein [Populus trichocarpa] 0.662 0.314 0.588 4e-86
224122938371 predicted protein [Populus trichocarpa] 0.662 0.708 0.583 1e-84
224113157 786 predicted protein [Populus trichocarpa] 0.790 0.399 0.468 6e-81
224113153 785 predicted protein [Populus trichocarpa] 0.790 0.4 0.468 7e-81
224115136 843 predicted protein [Populus trichocarpa] 0.727 0.342 0.51 3e-78
356545297 824 PREDICTED: G-type lectin S-receptor-like 0.846 0.407 0.452 4e-78
356546914 788 PREDICTED: G-type lectin S-receptor-like 0.818 0.412 0.450 1e-76
>gi|224113149|ref|XP_002332642.1| predicted protein [Populus trichocarpa] gi|222832837|gb|EEE71314.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  332 bits (851), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 179/346 (51%), Positives = 230/346 (66%), Gaps = 21/346 (6%)

Query: 46  TGNLVLTSQNKS-VVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPS 104
           TGNLVL S N S VVWS+N SK+     + +LLDSGNLVLR E+D  S  YLWQS DYPS
Sbjct: 92  TGNLVLVSNNNSTVVWSSN-SKKAAQSAMGELLDSGNLVLRDEKDANSGIYLWQSFDYPS 150

Query: 105 DTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYRTG 164
           DTLLPGMKLGWDL+ GL+RR+++WKS DDPS GDF W  + Q  PELVMWKGS+++YR+G
Sbjct: 151 DTLLPGMKLGWDLRIGLDRRLSAWKSPDDPSSGDFTWGTQLQSNPELVMWKGSKEYYRSG 210

Query: 165 PWNGIIFSAS-SLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWR 223
           PWNGI FS    LR+N +F + FV + +E+YYT+ L +K++I+RIVMNQ+   RQR+ W 
Sbjct: 211 PWNGIGFSGGPELRINPVFYFDFVDDGEEVYYTYNLKNKSLITRIVMNQSTYFRQRYTWN 270

Query: 224 KKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGR---FVDWSQGC 280
           + NQ+W LY+N+P+D CD+Y LCGA G  IISQSP+C+CLE F   S      +DWSQGC
Sbjct: 271 EINQTWVLYANVPRDYCDTYSLCGAYGNCIISQSPVCECLEKFTPKSPESWNSMDWSQGC 330

Query: 281 VRNKPLNYSRRDGFIKFSELKLPDSTSSWETTEEPIGKVKIKTKTWSYHCFELATIAIAT 340
           VRNKPL+  + DGF+K+  LKLPD+T+SW           +  K     C E  +    T
Sbjct: 331 VRNKPLDCQKGDGFVKYVGLKLPDATNSWVNK-------TMNLKECRSICLENCSCMAYT 383

Query: 341 DNFSTNKKLGEGG---FGPVYKGTL--ADGQEIVVKRFSKISEQGL 381
              +TN K   G    FG +   T   A GQEI ++  +  S + L
Sbjct: 384 ---ATNIKERSGCAIWFGDLIDITQLPAAGQEIYIRMNASESSECL 426




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224151394|ref|XP_002337099.1| predicted protein [Populus trichocarpa] gi|222838019|gb|EEE76384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124250|ref|XP_002319283.1| predicted protein [Populus trichocarpa] gi|222857659|gb|EEE95206.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126243|ref|XP_002319790.1| predicted protein [Populus trichocarpa] gi|222858166|gb|EEE95713.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122938|ref|XP_002330401.1| predicted protein [Populus trichocarpa] gi|222871786|gb|EEF08917.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113157|ref|XP_002332644.1| predicted protein [Populus trichocarpa] gi|222832839|gb|EEE71316.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113153|ref|XP_002332643.1| predicted protein [Populus trichocarpa] gi|222832838|gb|EEE71315.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115136|ref|XP_002316951.1| predicted protein [Populus trichocarpa] gi|222860016|gb|EEE97563.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356545297|ref|XP_003541080.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Back     alignment and taxonomy information
>gi|356546914|ref|XP_003541865.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
TAIR|locus:2141181 850 RK3 "receptor kinase 3" [Arabi 0.700 0.327 0.416 3.2e-75
TAIR|locus:2131684 783 AT4G27290 [Arabidopsis thalian 0.652 0.330 0.424 2.3e-74
TAIR|locus:2018546 843 RK1 "receptor kinase 1" [Arabi 0.654 0.308 0.396 1.9e-64
TAIR|locus:2059103 828 AT2G19130 [Arabidopsis thalian 0.662 0.317 0.378 1.6e-54
TAIR|locus:2141176 849 B120 [Arabidopsis thaliana (ta 0.629 0.294 0.323 9.9e-50
TAIR|locus:2088619439 AT3G12000 [Arabidopsis thalian 0.801 0.724 0.367 4.1e-49
TAIR|locus:2200151 830 SD1-13 "S-domain-1 13" [Arabid 0.790 0.378 0.300 4.3e-48
TAIR|locus:2018506 847 RK2 "receptor kinase 2" [Arabi 0.811 0.380 0.347 8.6e-48
TAIR|locus:2131694 815 AT4G27300 [Arabidopsis thalian 0.795 0.387 0.364 6.7e-47
TAIR|locus:2200888 804 AT1G61500 [Arabidopsis thalian 0.629 0.310 0.339 9.6e-47
TAIR|locus:2141181 RK3 "receptor kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 606 (218.4 bits), Expect = 3.2e-75, Sum P(2) = 3.2e-75
 Identities = 119/286 (41%), Positives = 177/286 (61%)

Query:    44 IPTGNLVLTSQNKSVVWSANLSK-EVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDY 102
             I   NLV+  Q+ + VWS NL+  +VR+P+V +LLD+GN VLR  ++   +  LWQS D+
Sbjct:    99 ISDSNLVVLDQSDTPVWSTNLTGGDVRSPLVAELLDNGNFVLRDSKNSAPDGVLWQSFDF 158

Query:   103 PSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYR 162
             P+DTLLP MKLGWD KTG  R I SWKS DDPS GDF +K+E + +PE+ +W    + YR
Sbjct:   159 PTDTLLPEMKLGWDAKTGFNRFIRSWKSPDDPSSGDFSFKLETEGFPEIFLWNRESRMYR 218

Query:   163 TGPWNGIIFSA-SSLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFI 221
             +GPWNGI FS    ++      ++F ++++E+ Y+F +T   V SR+ ++ +  L QRF 
Sbjct:   219 SGPWNGIRFSGVPEMQPFEYMVFNFTTSKEEVTYSFRITKSDVYSRLSISSS-GLLQRFT 277

Query:   222 WRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGFLTNSGR---FVDWSQ 278
             W +  Q+W  +   PKDQCD Y  CG  G    + SP+C C++GF   + +     D S 
Sbjct:   278 WIETAQNWNQFWYAPKDQCDEYKECGVYGYCDSNTSPVCNCIKGFKPRNPQVWGLRDGSD 337

Query:   279 GCVRNKPLNYSRRDGFIKFSELKLPDSTSSWETTEEPIGKVKIKTK 324
             GCVR   L+    DGF++  ++KLPD+T++  + +  IG  + + K
Sbjct:   338 GCVRKTLLSCGGGDGFVRLKKMKLPDTTTA--SVDRGIGVKECEQK 381


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0048544 "recognition of pollen" evidence=IEA
GO:0004675 "transmembrane receptor protein serine/threonine kinase activity" evidence=ISS
GO:0005773 "vacuole" evidence=IDA
GO:0031625 "ubiquitin protein ligase binding" evidence=IPI
GO:0009506 "plasmodesma" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=RCA
TAIR|locus:2131684 AT4G27290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018546 RK1 "receptor kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059103 AT2G19130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141176 B120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088619 AT3G12000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200151 SD1-13 "S-domain-1 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018506 RK2 "receptor kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131694 AT4G27300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200888 AT1G61500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
pfam00954110 pfam00954, S_locus_glycop, S-locus glycoprotein fa 2e-32
pfam01453109 pfam01453, B_lectin, D-mannose binding lectin 3e-25
cd00028116 cd00028, B_lectin, Bulb-type mannose-specific lect 1e-10
smart00108114 smart00108, B_lectin, Bulb-type mannose-specific l 3e-09
PLN03225 566 PLN03225, PLN03225, Serine/threonine-protein kinas 3e-04
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 0.002
>gnl|CDD|201524 pfam00954, S_locus_glycop, S-locus glycoprotein family Back     alignment and domain information
 Score =  118 bits (297), Expect = 2e-32
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 2/107 (1%)

Query: 161 YRTGPWNGIIFSASS-LRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQR 219
           +R+GPWNGI FS    ++    + Y+F  N +E+YYT+ +T+ ++ SR+ ++   SL +R
Sbjct: 1   WRSGPWNGIRFSGIPEMQKLSYYVYNFTENNEEVYYTYRMTNNSIYSRLTLSSEGSL-ER 59

Query: 220 FIWRKKNQSWELYSNLPKDQCDSYGLCGANGIFIISQSPICQCLEGF 266
           F W   +Q W L+ + PKDQCD YG CG  G   ++ SP C C++GF
Sbjct: 60  FTWIPNSQDWNLFWSAPKDQCDVYGRCGPYGYCDVNTSPKCNCIKGF 106


In Brassicaceae, self-incompatible plants have a self/non-self recognition system. This is sporophytically controlled by multiple alleles at a single locus (S). S-locus glycoproteins, as well as S-receptor kinases, are in linkage with the S-alleles. Length = 110

>gnl|CDD|216511 pfam01453, B_lectin, D-mannose binding lectin Back     alignment and domain information
>gnl|CDD|237995 cd00028, B_lectin, Bulb-type mannose-specific lectin Back     alignment and domain information
>gnl|CDD|214519 smart00108, B_lectin, Bulb-type mannose-specific lectin Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 397
PF00954110 S_locus_glycop: S-locus glycoprotein family; Inter 99.95
PF01453114 B_lectin: D-mannose binding lectin; InterPro: IPR0 99.9
cd00028116 B_lectin Bulb-type mannose-specific lectin. The do 99.73
smart00108114 B_lectin Bulb-type mannose-specific lectin. 99.66
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.08
smart00108114 B_lectin Bulb-type mannose-specific lectin. 98.75
cd00028116 B_lectin Bulb-type mannose-specific lectin. The do 98.68
PF01453114 B_lectin: D-mannose binding lectin; InterPro: IPR0 97.44
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 97.41
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 97.08
KOG0595 429 consensus Serine/threonine-protein kinase involved 96.88
PLN03224 507 probable serine/threonine protein kinase; Provisio 96.79
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 96.71
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 96.59
PRK09188 365 serine/threonine protein kinase; Provisional 96.42
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 96.34
KOG0192 362 consensus Tyrosine kinase specific for activated ( 96.18
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 96.16
PTZ00284 467 protein kinase; Provisional 96.15
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 96.13
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 96.12
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 96.11
PHA02988 283 hypothetical protein; Provisional 96.05
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 96.03
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 95.99
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 95.98
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 95.97
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 95.95
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 95.94
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 95.91
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 95.78
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 95.75
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 95.73
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 95.73
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 95.7
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 95.66
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 95.66
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 95.65
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 95.64
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 95.59
KOG3653 534 consensus Transforming growth factor beta/activin 95.56
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 95.49
KOG1989 738 consensus ARK protein kinase family [Signal transd 95.48
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 95.47
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 95.44
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 95.4
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 95.38
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 95.28
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 95.26
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 95.21
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 95.2
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 95.19
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 95.14
PLN00034 353 mitogen-activated protein kinase kinase; Provision 95.13
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 95.11
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 95.1
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 95.08
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 95.07
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 95.05
PTZ00263 329 protein kinase A catalytic subunit; Provisional 95.04
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 95.01
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 94.98
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 94.98
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 94.97
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 94.96
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 94.96
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 94.96
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 94.95
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 94.93
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 94.9
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 94.89
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 94.86
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 94.83
KOG0575 592 consensus Polo-like serine/threonine protein kinas 94.78
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 94.76
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 94.76
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 94.75
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 94.74
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 94.7
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 94.69
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 94.64
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 94.59
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 94.57
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 94.54
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 94.54
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 94.52
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 94.5
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 94.49
PTZ00283 496 serine/threonine protein kinase; Provisional 94.46
KOG0201 467 consensus Serine/threonine protein kinase [Signal 94.43
PTZ00036 440 glycogen synthase kinase; Provisional 94.43
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 94.41
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 94.4
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 94.4
KOG0198 313 consensus MEKK and related serine/threonine protei 94.38
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 94.32
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 94.31
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 94.24
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 94.21
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 94.17
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 94.13
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 94.11
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 94.1
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 94.09
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 94.07
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 94.03
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 94.02
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 93.98
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 93.97
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 93.96
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 93.94
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 93.93
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 93.93
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 93.83
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 93.81
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 93.81
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 93.75
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 93.75
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 93.71
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 93.68
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 93.68
KOG2052 513 consensus Activin A type IB receptor, serine/threo 93.67
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 93.62
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 93.61
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 93.59
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 93.59
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 93.58
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 93.57
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 93.51
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 93.48
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 93.48
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 93.47
KOG0598 357 consensus Ribosomal protein S6 kinase and related 93.47
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 93.46
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 93.38
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 93.38
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 93.33
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 93.24
cd05144 198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 93.24
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 93.24
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 93.23
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 93.14
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 93.14
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 93.12
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 93.09
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 93.09
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 93.03
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 92.99
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 92.96
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 92.95
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 92.94
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 92.89
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 92.88
KOG0605 550 consensus NDR and related serine/threonine kinases 92.86
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 92.84
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 92.81
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 92.78
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 92.67
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 92.64
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 92.58
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 92.58
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 92.56
PHA03212 391 serine/threonine kinase US3; Provisional 92.53
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 92.42
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 92.18
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 92.12
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 92.08
PTZ00024 335 cyclin-dependent protein kinase; Provisional 91.91
KOG0577 948 consensus Serine/threonine protein kinase [Signal 91.72
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 91.65
KOG0661 538 consensus MAPK related serine/threonine protein ki 91.56
PHA03211 461 serine/threonine kinase US3; Provisional 91.32
smart00090 237 RIO RIO-like kinase. 91.31
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 91.22
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 91.08
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 90.85
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 90.7
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 90.68
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 90.66
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 90.61
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 90.49
PHA03209 357 serine/threonine kinase US3; Provisional 90.47
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 90.45
KOG0694 694 consensus Serine/threonine protein kinase [Signal 90.26
PTZ00266 1021 NIMA-related protein kinase; Provisional 90.03
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 89.89
PRK09605 535 bifunctional UGMP family protein/serine/threonine 89.49
KOG0581 364 consensus Mitogen-activated protein kinase kinase 89.25
PTZ00267 478 NIMA-related protein kinase; Provisional 89.05
KOG1167 418 consensus Serine/threonine protein kinase of the C 88.61
KOG0596 677 consensus Dual specificity; serine/threonine and t 88.35
PHA03207 392 serine/threonine kinase US3; Provisional 88.17
PHA02882 294 putative serine/threonine kinase; Provisional 88.07
KOG0578 550 consensus p21-activated serine/threonine protein k 87.99
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 87.91
KOG0582 516 consensus Ste20-like serine/threonine protein kina 87.54
KOG0583 370 consensus Serine/threonine protein kinase [Signal 87.37
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 87.09
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 86.41
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 86.09
KOG0611 668 consensus Predicted serine/threonine protein kinas 85.87
KOG0607 463 consensus MAP kinase-interacting kinase and relate 85.84
COG0661 517 AarF Predicted unusual protein kinase [General fun 85.72
PHA03210 501 serine/threonine kinase US3; Provisional 85.63
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 85.48
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 85.12
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 84.52
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 84.06
PRK10359 232 lipopolysaccharide core biosynthesis protein; Prov 83.9
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 83.6
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 82.89
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 82.7
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 82.68
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 82.16
cd0005336 EGF Epidermal growth factor domain, found in epide 82.11
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 82.07
KOG0586 596 consensus Serine/threonine protein kinase [General 80.95
>PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation Back     alignment and domain information
Probab=99.95  E-value=6.9e-28  Score=197.56  Aligned_cols=109  Identities=46%  Similarity=0.995  Sum_probs=102.9

Q ss_pred             EEcCCCCCeeeeec-ccccceeEEEEEEEcCCeEEEEEEeCCCCeEEEEEEecccCeEEEEEeecCCCceEEEeeccCCc
Q 038392          161 YRTGPWNGIIFSAS-SLRLNLIFKYHFVSNEDELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRKKNQSWELYSNLPKDQ  239 (397)
Q Consensus       161 w~~g~~~g~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rl~L~~dG~~l~~y~~~~~~~~W~~~~~~p~~~  239 (397)
                      ||+|+|+|..|+++ +|....++.+.|+.++++.+++|.+.+.+.++|++|+++| ++++|.|.+..+.|..+|.+|.++
T Consensus         1 wrsG~WnG~~f~g~p~~~~~~~~~~~fv~~~~e~~~t~~~~~~s~~~r~~ld~~G-~l~~~~w~~~~~~W~~~~~~p~d~   79 (110)
T PF00954_consen    1 WRSGPWNGQRFSGIPEMSSNSLYNYSFVSNNEEVYYTYSLSNSSVLSRLVLDSDG-QLQRYIWNESTQSWSVFWSAPKDQ   79 (110)
T ss_pred             CCccccCCeEECCcccccccceeEEEEEECCCeEEEEEecCCCceEEEEEEeeee-EEEEEEEecCCCcEEEEEEecccC
Confidence            89999999999999 8887777889999999999999998888899999999999 999999999999999999999999


Q ss_pred             ccccCCCCCceeeccCCCCCccccCCcccCC
Q 038392          240 CDSYGLCGANGIFIISQSPICQCLEGFLTNS  270 (397)
Q Consensus       240 C~~~~~CG~~giC~~~~~~~C~C~~gf~~~~  270 (397)
                      ||+|+.||+||+|+.+..+.|+|++||+|++
T Consensus        80 Cd~y~~CG~~g~C~~~~~~~C~Cl~GF~P~n  110 (110)
T PF00954_consen   80 CDVYGFCGPNGICNSNNSPKCSCLPGFEPKN  110 (110)
T ss_pred             CCCccccCCccEeCCCCCCceECCCCcCCCc
Confidence            9999999999999888889999999999874



This is sporophytically controlled by multiple alleles at a single locus (S). There are a total of 50 different S alleles in Brassica oleracea. S-locus glycoproteins, as well as S-receptor kinases, are in linkage with the S-alleles []. Most of the proteins within this family contain apple-like domain (IPR003609 from INTERPRO), which is predicted to possess protein- and/or carbohydrate-binding functions.; GO: 0048544 recognition of pollen

>PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity Back     alignment and domain information
>cd00028 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>smart00108 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00108 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>cd00028 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 6e-08
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 2e-07
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 5e-04
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 5e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 26/50 (52%), Positives = 31/50 (62%) Query: 331 FELATIAIATDNFSTNKKLGEGGFGPVYKGTLADGQEIVVKRFSKISEQG 380 F L + +A+DNFS LG GGFG VYKG LADG + VKR + QG Sbjct: 28 FSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQG 77
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-19
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 6e-17
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-14
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-08
3soc_A 322 Activin receptor type-2A; structural genomics cons 7e-08
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 3e-05
1kj1_A109 Lectin I, lecgna 1; BULB lectin, mannose, plant pr 6e-05
1kj1_A109 Lectin I, lecgna 1; BULB lectin, mannose, plant pr 8e-04
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 6e-05
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-04
2a19_B 284 Interferon-induced, double-stranded RNA-activated 4e-04
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 4e-04
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 5e-04
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 5e-04
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 6e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score = 88.0 bits (219), Expect = 1e-19
 Identities = 25/82 (30%), Positives = 37/82 (45%)

Query: 305 STSSWETTEEPIGKVKIKTKTWSYHCFELATIAIATDNFSTNKKLGEGGFGPVYKGTLAD 364
           S  S  T              +  +   L  +  AT+NF     +G G FG VYKG L D
Sbjct: 3   SKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRD 62

Query: 365 GQEIVVKRFSKISEQGLKELKN 386
           G ++ +KR +  S QG++E + 
Sbjct: 63  GAKVALKRRTPESSQGIEEFET 84


>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1kj1_A Lectin I, lecgna 1; BULB lectin, mannose, plant protein; HET: MAN; 2.20A {Allium sativum} SCOP: b.78.1.1 PDB: 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Length = 109 Back     alignment and structure
>1kj1_A Lectin I, lecgna 1; BULB lectin, mannose, plant protein; HET: MAN; 2.20A {Allium sativum} SCOP: b.78.1.1 PDB: 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Length = 109 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 109 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
3m7h_A276 Putidacin L1; monocot mannose-binding lectin, bact 99.97
1dlp_A236 Lectin scafet precursor; two-domain lectin, beta p 99.96
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 99.69
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 99.67
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 99.65
2dpf_A115 Curculin; sweet taste, taste modifying, plant prot 99.63
3mez_B113 Mannose-specific lectin 3 chain 2; heterotetramer, 99.42
3mez_A111 Mannose-specific lectin 3 chain 1; heterotetramer, 99.3
4h3o_A105 Lectin; cadmium, plant protein; 2.17A {Allium sati 99.29
3dzw_A109 Agglutinin; lectin, mannobiose, mannose-alpha1, 3- 99.27
3r0e_B110 Lectin; carbohydrate binding, carbohydrate, sugar 99.23
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 99.22
2dpf_A115 Curculin; sweet taste, taste modifying, plant prot 99.18
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 99.15
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 99.13
4h3o_A105 Lectin; cadmium, plant protein; 2.17A {Allium sati 99.05
3dzw_A109 Agglutinin; lectin, mannobiose, mannose-alpha1, 3- 98.95
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 98.9
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 98.84
1dlp_A236 Lectin scafet precursor; two-domain lectin, beta p 98.8
3mez_B113 Mannose-specific lectin 3 chain 2; heterotetramer, 98.76
3r0e_B110 Lectin; carbohydrate binding, carbohydrate, sugar 98.76
3m7h_A276 Putidacin L1; monocot mannose-binding lectin, bact 98.34
3mez_A111 Mannose-specific lectin 3 chain 1; heterotetramer, 98.31
4aoj_A 329 High affinity nerve growth factor receptor; transf 98.02
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 97.99
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 97.81
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 97.75
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.66
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 97.62
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.61
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 97.4
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 97.33
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 97.32
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 97.27
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.19
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 97.19
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 97.06
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 97.04
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 96.98
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 96.97
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 96.94
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 96.9
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 96.9
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 96.81
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 96.8
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 96.78
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 96.75
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 96.71
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 96.69
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 96.68
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 96.67
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 96.66
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 96.65
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 96.58
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 96.57
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 96.54
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 96.54
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 96.53
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 96.51
3niz_A 311 Rhodanese family protein; structural genomics, str 96.5
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 96.49
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 96.47
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 96.45
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 96.44
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 96.44
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 96.44
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 96.4
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 96.38
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 96.37
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 96.37
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 96.36
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 96.31
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 96.31
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 96.3
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 96.3
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 96.29
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 96.29
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 96.28
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 96.27
3soc_A 322 Activin receptor type-2A; structural genomics cons 96.25
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 96.22
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 96.19
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 96.18
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 96.18
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 96.17
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 96.15
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 96.15
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 96.14
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 96.12
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 96.09
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 96.08
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 96.08
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 96.07
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 96.07
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 96.06
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 96.06
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 96.04
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 96.03
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 96.02
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 96.02
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 96.02
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 96.01
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 96.01
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 95.98
3rp9_A 458 Mitogen-activated protein kinase; structural genom 95.98
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 95.97
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 95.94
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 95.94
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 95.92
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 95.92
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 95.92
3uqc_A 286 Probable conserved transmembrane protein; structur 95.92
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 95.9
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 95.9
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 95.89
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 95.86
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 95.85
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 95.84
3q4u_A 301 Activin receptor type-1; structural genomics conso 95.82
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 95.81
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 95.81
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 95.79
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 95.78
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 95.78
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 95.77
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 95.77
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 95.76
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 95.76
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 95.75
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 95.74
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 95.73
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 95.73
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 95.71
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 95.71
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 95.67
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 95.66
3bhy_A 283 Death-associated protein kinase 3; death associate 95.66
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 95.65
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 95.64
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 95.63
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 95.63
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 95.63
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 95.62
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 95.6
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 95.6
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 95.6
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 95.6
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 95.59
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 95.58
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 95.58
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 95.56
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 95.55
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 95.55
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 95.52
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 95.52
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 95.52
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 95.52
3ork_A 311 Serine/threonine protein kinase; structural genomi 95.5
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 95.49
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 95.49
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 95.48
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 95.47
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 95.47
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 95.44
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 95.44
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 95.44
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 95.44
3pls_A 298 Macrophage-stimulating protein receptor; protein k 95.44
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 95.43
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 95.42
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 95.41
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 95.41
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 95.4
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 95.38
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 95.37
2a19_B 284 Interferon-induced, double-stranded RNA-activated 95.37
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 95.37
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 95.37
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 95.34
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 95.34
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 95.34
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 95.34
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 95.34
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 95.33
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 95.33
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 95.31
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 95.31
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 95.31
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 95.3
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 95.29
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 95.28
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 95.28
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 95.25
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 95.2
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 95.2
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 95.2
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 95.19
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 95.19
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 95.16
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 95.15
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 95.15
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 95.13
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 95.12
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 95.11
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 95.11
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 95.11
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 95.07
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 95.07
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 95.05
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 95.05
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 95.02
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 95.01
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 95.01
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 95.01
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 95.01
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 94.97
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 94.97
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 94.96
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 94.96
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 94.95
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 94.93
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 94.9
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 94.9
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 94.85
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 94.83
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 94.83
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 94.8
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 94.79
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 94.78
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 94.78
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 94.73
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 94.68
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 94.67
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 94.64
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 94.62
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 94.56
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 94.53
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 94.5
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 94.49
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 94.47
3an0_A 340 Dual specificity mitogen-activated protein kinase; 94.42
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 94.38
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 94.33
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 94.31
3aln_A 327 Dual specificity mitogen-activated protein kinase; 94.29
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 94.24
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 94.15
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 94.1
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 93.99
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 93.88
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 93.8
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 93.77
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 93.76
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 93.74
3fme_A 290 Dual specificity mitogen-activated protein kinase; 93.69
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 93.58
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 93.51
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 93.37
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 93.34
2dyl_A 318 Dual specificity mitogen-activated protein kinase 93.05
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 92.91
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 92.65
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 92.5
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 91.88
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 91.8
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 91.23
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 90.26
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 89.96
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 89.86
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 88.27
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 87.7
>3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Back     alignment and structure
Probab=99.97  E-value=1.2e-32  Score=259.79  Aligned_cols=202  Identities=13%  Similarity=0.111  Sum_probs=144.0

Q ss_pred             CCCCeEEEeecCCCCCCceEE-e----e-CCCCCCCCCCC----CC---cCCCCcEEE--EcCCCCEEEecCCCCC----
Q 038392            7 TRPVWKKSGFNSGSGERKWHP-G----L-EPRRLNPDPDP----DF---AIPTGNLVL--TSQNKSVVWSANLSKE----   67 (397)
Q Consensus         7 ~~~~~f~lGF~~~~~~~~~yl-g----i-~~~r~~pv~~~----s~---l~~~G~LvL--~d~~g~~vWss~~~~~----   67 (397)
                      .++.| +||||+++   ++|| .    | ..+|++||.++    ++   |+.+|+|+|  .|++|++||+++++..    
T Consensus        32 ~~g~F-~lgf~~~~---~~~ly~~~~vvW~Anr~~p~~~~~~~~~~~l~l~~~G~Lvl~~~~~~~~~vWst~~~~~~~~~  107 (276)
T 3m7h_A           32 PNQRF-KLLLQGDG---NLVIQDNGATVWVANEQQPFSSTIPLRNKKAPLAFYVQYGAFLDDYSRRRVWLTDNSTFTSND  107 (276)
T ss_dssp             TTSSE-EEEECTTS---CEEEEETTEEEEECSTTSTTEEEEECCCTTCCSEEEESSSEEEEEGGGTEEEEECCCCCCCTT
T ss_pred             CCCcE-EEEEECCC---CeEEECCCCeEEECCCCCCcCCcccccceEEEEeCCCcEEEEEeCCCCCEEEEeCCCcccccc
Confidence            45666 99999532   4454 1    1 34699999873    33   788999999  7888899999997642    


Q ss_pred             -CCCcEEeeeecCCCEEEEeccCCCCCcccccccCCCCCCcCCCceeccccCCCceeEEEEccCCCCCCCccceeeeccC
Q 038392           68 -VRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLPGMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQ  146 (397)
Q Consensus        68 -~~~~~a~~LldsGNlVL~~~~~~~~~~~~WqSFd~PTDTlLpgq~l~~~~~t~~~~~L~S~~s~~dps~G~f~l~~~~~  146 (397)
                       ..+++| +|+|+|||||++      +.+||||  ||||||||||+|+.+..+|  +.|   ++.+||++|.|+++++++
T Consensus       108 ~~~~~~a-~L~d~GNlVl~~------~~~lWqS--~ptdtlLpg~~~~~~l~~g--~~L---~S~~dps~G~fsl~l~~d  173 (276)
T 3m7h_A          108 QWNRTHL-VLQDDGNIVLVD------SLALWNG--TPAIPLVPGAIDSLLLAPG--SEL---VQGVVYGAGASKLVFQGD  173 (276)
T ss_dssp             HHHHEEE-EECTTSCEEEEE------EEEEEES--CTTSCCCCSCTTCEEECSS--EEE---CTTCEEEETTEEEEECTT
T ss_pred             cCCceEE-EEeCCCCEEecC------CceeeCc--ccccccccccccccccccC--ccc---ccCCCCCCceEEEeecCC
Confidence             123556 999999999997      3689999  9999999999987777766  447   568899999999999999


Q ss_pred             CCcEEEEEc-CCeeEEEcCCCCCeeeeecccccceeEEEEEEEcCC-eEEEEEEeCCCCeEEEEEEecccCeEEEEEeec
Q 038392          147 FYPELVMWK-GSRKFYRTGPWNGIIFSASSLRLNLIFKYHFVSNED-ELYYTFYLTDKAVISRIVMNQTVSLRQRFIWRK  224 (397)
Q Consensus       147 ~~~~~~~~~-~~~~yw~~g~~~g~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~rl~L~~dG~~l~~y~~~~  224 (397)
                      +.  +++++ +..+||++++|...... ..+...+  .+.+.++.+ .+..++  ......+|++|+.|| +|++|.|  
T Consensus       174 Gn--lvLy~~~~~~yW~Sgt~~~~~~~-l~l~~dG--nLvl~d~~~~~vWsS~--t~~~~~~rl~Ld~dG-nLvly~~--  243 (276)
T 3m7h_A          174 GN--LVAYGPNGAATWNAGTQGKGAVR-AVFQGDG--NLVVYGAGNAVLWHSH--TGGHASAVLRLQANG-SIAILDE--  243 (276)
T ss_dssp             SC--EEEECTTSSEEEECCCTTTTCCE-EEECTTS--CEEEECTTSCEEEECS--CTTCTTCEEEECTTS-CEEEEEE--
T ss_pred             ce--EEEEeCCCeEEEECCCCCCccEE-EEEcCCC--eEEEEeCCCcEEEEec--CCCCCCEEEEEcCCc-cEEEEcC--
Confidence            86  44565 46899999998753311 1333222  123344433 232222  222234799999999 9999998  


Q ss_pred             CCCceEEEeeccC
Q 038392          225 KNQSWELYSNLPK  237 (397)
Q Consensus       225 ~~~~W~~~~~~p~  237 (397)
                       ...|..++.+|.
T Consensus       244 -~~~Wqsf~~~P~  255 (276)
T 3m7h_A          244 -KPVWARFGFQPT  255 (276)
T ss_dssp             -EEEEESSSCCTT
T ss_pred             -CCeEEccCccCC
Confidence             235766666664



>1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Back     alignment and structure
>2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Back     alignment and structure
>3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Back     alignment and structure
>3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Back     alignment and structure
>3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Back     alignment and structure
>2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Back     alignment and structure
>4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Back     alignment and structure
>3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Back     alignment and structure
>3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Back     alignment and structure
>3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 397
d1kj1a_109 b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium 1e-07
d1kj1a_109 b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium 0.004
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-07
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-07
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-07
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-07
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 4e-07
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 7e-07
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-06
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-06
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-06
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 5e-06
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-06
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 7e-06
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 9e-06
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 9e-06
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-05
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-05
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-05
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-05
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-05
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-05
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-05
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-05
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-05
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-05
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-05
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-05
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-05
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-05
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-05
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-05
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-05
d1b2pa_119 b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scill 5e-05
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-05
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 6e-05
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 6e-05
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 8e-05
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-04
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-04
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-04
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-04
d1zara2 191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-04
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-04
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-04
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-04
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-04
d1jpca_108 b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galan 2e-04
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-04
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-04
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-04
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-04
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-04
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-04
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-04
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 6e-04
d1dlpa2120 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet 8e-04
d1dlpa2120 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet 0.002
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 8e-04
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 8e-04
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 9e-04
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 0.001
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 0.001
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 0.001
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 0.002
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 0.002
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 0.002
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 0.003
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 0.004
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Length = 109 Back     information, alignment and structure

class: All beta proteins
fold: beta-Prism II
superfamily: alpha-D-mannose-specific plant lectins
family: alpha-D-mannose-specific plant lectins
domain: Lectin (agglutinin)
species: Garlic (Allium sativum) [TaxId: 4682]
 Score = 47.6 bits (113), Expect = 1e-07
 Identities = 12/55 (21%), Positives = 23/55 (41%), Gaps = 8/55 (14%)

Query: 45  PTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQS 99
             GN V+       +W+++  +      VL L + GN+V+ G         +W +
Sbjct: 59  SDGNFVVYDAEGRSLWASHSVRG-NGNYVLVLQEDGNVVIYGSD-------IWST 105


>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Length = 109 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 119 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Length = 108 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 120 Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 120 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
d1dlpa1115 Fetuin-binding protein Scafet precursor {Bluebell 99.52
d1dlpa2120 Fetuin-binding protein Scafet precursor {Bluebell 99.45
d1jpca_108 Lectin (agglutinin) {Snowdrop (Galanthus nivalis) 99.33
d1kj1a_109 Lectin (agglutinin) {Garlic (Allium sativum) [TaxI 99.32
d1xd5a_112 Gastrodianin (antifungal protein) {Gastrodia elata 99.32
d1b2pa_119 Lectin (agglutinin) {Bluebell (Scilla campanulata) 99.18
d1jpca_108 Lectin (agglutinin) {Snowdrop (Galanthus nivalis) 99.07
d1kj1a_109 Lectin (agglutinin) {Garlic (Allium sativum) [TaxI 99.07
d1dlpa2120 Fetuin-binding protein Scafet precursor {Bluebell 99.01
d1xd5a_112 Gastrodianin (antifungal protein) {Gastrodia elata 98.88
d1b2pa_119 Lectin (agglutinin) {Bluebell (Scilla campanulata) 98.64
d1dlpa1115 Fetuin-binding protein Scafet precursor {Bluebell 98.38
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 97.99
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 97.99
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 97.86
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 97.85
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 97.81
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 97.74
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 97.65
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 97.62
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 97.59
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 97.47
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 97.4
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 97.39
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 97.38
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 97.37
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 97.33
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 97.32
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 97.28
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 97.27
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 97.25
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 97.25
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 97.24
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 97.18
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 97.16
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 97.14
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 97.13
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 97.12
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 97.11
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 97.1
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 97.08
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 97.08
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 97.05
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 97.04
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 97.02
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 96.98
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 96.95
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 96.93
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 96.9
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 96.88
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 96.87
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 96.86
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 96.85
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 96.77
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 96.76
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 96.72
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 96.69
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 96.45
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 96.37
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 96.3
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 96.27
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 96.2
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 96.06
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 96.04
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 95.57
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.35
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 89.21
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 87.07
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 84.12
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 81.44
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 81.28
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
class: All beta proteins
fold: beta-Prism II
superfamily: alpha-D-mannose-specific plant lectins
family: alpha-D-mannose-specific plant lectins
domain: Fetuin-binding protein Scafet precursor
species: Bluebell (Scilla campanulata) [TaxId: 81759]
Probab=99.52  E-value=7.3e-15  Score=117.74  Aligned_cols=91  Identities=20%  Similarity=0.277  Sum_probs=73.4

Q ss_pred             CCCCCCCCCC---cCCCCcEEEEcCCCCEEEecCCCCCCCCcEEeeeecCCCEEEEeccCCCCCcccccccCCCCCCcCC
Q 038392           33 RLNPDPDPDF---AIPTGNLVLTSQNKSVVWSANLSKEVRTPVVLQLLDSGNLVLRGERDGGSETYLWQSLDYPSDTLLP  109 (397)
Q Consensus        33 r~~pv~~~s~---l~~~G~LvL~d~~g~~vWss~~~~~~~~~~a~~LldsGNlVL~~~~~~~~~~~~WqSFd~PTDTlLp  109 (397)
                      .++++.+.+.   +..||||||++. +.++|++++.+ ..++.+ .|+++|||||++..    +++||||+.        
T Consensus        19 ~~~~l~~g~~~l~~q~DGNLvL~~~-~~~vW~s~t~~-~~~~~l-~l~~dGNLvl~d~~----~~~vWsS~t--------   83 (115)
T d1dlpa1          19 AAQSLELSSFRFTMQSDCNLVLFDS-DVRVWASNTAG-ATGCRA-VLQSDGLLVILTAQ----NTIRWSSGT--------   83 (115)
T ss_dssp             TTCEECSTTEEEEECTTSCEEEEES-SSEEECCCCCS-CSCCBC-CBCSSSCBCCBCTT----TCCSCCCCC--------
T ss_pred             CCCcEEcCCEEEEECCCCeEEEEcC-CeeEEEcccCC-CCceEE-EEeccCCEEEEccC----CCEEEEcCC--------
Confidence            6778876665   789999999985 67999999875 346677 99999999999876    789999863        


Q ss_pred             CceeccccCCCceeEEEEccCCCCCCCccceeeeccCCCcEEEEEcCCeeEEEcCC
Q 038392          110 GMKLGWDLKTGLERRITSWKSSDDPSPGDFFWKIERQFYPELVMWKGSRKFYRTGP  165 (397)
Q Consensus       110 gq~l~~~~~t~~~~~L~S~~s~~dps~G~f~l~~~~~~~~~~~~~~~~~~yw~~g~  165 (397)
                                             +.++|.|.|.|+++|++.+  |  +.+||.+|+
T Consensus        84 -----------------------~~~~g~y~l~Lq~DGNlvl--Y--~~~~Wssgt  112 (115)
T d1dlpa1          84 -----------------------KGSIGNYVLVLQPDRTVTI--Y--GPGLWDSGT  112 (115)
T ss_dssp             -----------------------CCCSSCCEEEECSSSCEEE--E--CSEEEECSC
T ss_pred             -----------------------CCCCCCEEEEECCCCcEEE--e--CCCeecCCC
Confidence                                   3467899999999998644  4  458999886



>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Back     information, alignment and structure
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Back     information, alignment and structure
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure