Citrus Sinensis ID: 038431


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MASISISALGSSSSSSAIKPSSSVRHRFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN
cccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccEEcccccEEEEEEcccccccccccEEEEEEEEEEccccccEEECccccccccccccccccEEEEcccccccccHHHHHcccccccEEEEEEcccccccccccccccccccccccccHHHHHHcccccccccEEEEEEEEEEEcc
********LGSS**************RFHSKNNTPLLFHRQLA**************************VVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYG*********TETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASISISALGSSSSSSAIKPSSSVRHRFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableQ9LYR5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JXV, chain A
Confidence level:very confident
Coverage over the Query: 140-233,252-267
View the alignment between query and template
View the model in PyMOL
Template: 1FD9, chain A
Confidence level:very confident
Coverage over the Query: 108-233,252-266
View the alignment between query and template
View the model in PyMOL
Template: 1IX5, chain A
Confidence level:very confident
Coverage over the Query: 142-266
View the alignment between query and template
View the model in PyMOL