Citrus Sinensis ID: 038431

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MASISISALGSSSSSSAIKPSSSVRHRFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN
cccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccEEcccccEEEEEEcccccccccccEEEEEEEEEEccccccEEEEccccccccccccccccEEEEcccccccccHHHHHcccccccEEEEEEcccccccccccccccccccccccccHHHHHHcccccccccEEEEEEEEEEEcc
ccEEEEEEEccccccccEccccccccccccccccHcHHHHccccHHccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccEEEEEEcccccccccccEEEEEEEEEEEccccEEEEcccccccccEEEcccccEEEEccccEEEccHHHHHHHcccccEEEEEEcHHHcccccccccccccccccccccccccccccccccccEEEEEEEEEEEccc
MASISIsalgssssssaikpsssvrhrfhsknntpllfhrqlapqslhhphqfngsssygeishtsnrqVVERRRVLISSIGLLAVALFNASKDGVVLAAEfadmpalrgkdygktkmrypdytetesglqykdlrqgsgpkpkmgetvvvdwdgytigyYGRIFEarnktkggsfegddkdYFKFrlgsqdvipAFEEAVSGMAlggvrriivppeigypendynksgprpttfsgqRALDFVLRnqglidktllFDIELLKIIPN
masisisalgssssssaikpssSVRHRFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAaefadmpalrgkdygktkmrYPDYtetesglqykdlrqgsgpkpkmgetvvvdwdGYTIGYYGRIFearnktkggsfegDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNqglidktllfdiellkiipn
MasisisalgssssssaikpsssVRHRFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN
*********************************************************************VVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYG********************************ETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYP**************SGQRALDFVLRNQGLIDKTLLFDIELLKII**
********LGSS**************RFHSKNNTPLLFHRQLA**************************VVERRRVLISSIGLLAVALF**********************************TETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNK*******G**KDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIP*
**************************RFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN
*ASISISALGSSSSS*******SVRHRFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASISISALGSSSSSSAIKPSSSVRHRFHSKNNTPLLFHRQLAPQSLHHPHQFNGSSSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query267 2.2.26 [Sep-21-2011]
Q9LYR5256 Peptidyl-prolyl cis-trans yes no 0.790 0.824 0.773 2e-93
O81864229 Peptidyl-prolyl cis-trans no no 0.494 0.576 0.326 9e-11
Q54NB6364 FK506-binding protein 4 O yes no 0.382 0.280 0.325 7e-10
Q0WRJ7242 Peptidyl-prolyl cis-trans no no 0.415 0.458 0.293 3e-09
Q4WMV5489 FK506-binding protein 4 O yes no 0.385 0.210 0.316 3e-09
Q2UN37470 FK506-binding protein 4 O yes no 0.385 0.219 0.323 7e-09
Q26486412 46 kDa FK506-binding nucl N/A no 0.303 0.196 0.369 7e-09
O22870223 Peptidyl-prolyl cis-trans no no 0.434 0.520 0.333 2e-07
Q944B0207 Peptidyl-prolyl cis-trans no no 0.479 0.618 0.261 3e-06
Q59VR3426 FK506-binding protein 3 O N/A no 0.299 0.187 0.336 5e-06
>sp|Q9LYR5|FKB19_ARATH Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic OS=Arabidopsis thaliana GN=FKBP19 PE=1 SV=1 Back     alignment and function desciption
 Score =  342 bits (877), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 185/212 (87%), Gaps = 1/212 (0%)

Query: 57  SSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDG-VVLAAEFADMPALRGKDYGK 115
           SS G     +N    +RR++L+SS+GLL  AL   SKDG    A++FADMPAL+GKDYGK
Sbjct: 45  SSGGNCGCVNNSGEFDRRKLLVSSVGLLIGALSYDSKDGDFASASQFADMPALKGKDYGK 104

Query: 116 TKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGS 175
           TKM+YPDYTET+SGLQYKDLR G+GP  K G+ VVVDWDGYTIGYYGRIFEARNKTKGGS
Sbjct: 105 TKMKYPDYTETQSGLQYKDLRVGTGPIAKKGDKVVVDWDGYTIGYYGRIFEARNKTKGGS 164

Query: 176 FEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTF 235
           FEGDDK++FKF LGS +VIPAFEEAVSGMALGG+RRIIVPPE+GYP+NDYNKSGPRP TF
Sbjct: 165 FEGDDKEFFKFTLGSNEVIPAFEEAVSGMALGGIRRIIVPPELGYPDNDYNKSGPRPMTF 224

Query: 236 SGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267
           SGQRALDFVLRNQGLIDKTLLFD+ELLKI+PN
Sbjct: 225 SGQRALDFVLRNQGLIDKTLLFDVELLKIVPN 256
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|O81864|FK171_ARATH Peptidyl-prolyl cis-trans isomerase FKBP17-1, chloroplastic OS=Arabidopsis thaliana GN=FKBP17-1 PE=2 SV=1 Back     alignment and function description
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description
>sp|Q0WRJ7|FK202_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP20-2 PE=1 SV=1 Back     alignment and function description
>sp|Q4WMV5|FKBP4_ASPFU FK506-binding protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr4 PE=3 SV=2 Back     alignment and function description
>sp|Q2UN37|FKBP4_ASPOR FK506-binding protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr4 PE=3 SV=1 Back     alignment and function description
>sp|Q26486|FKBP4_SPOFR 46 kDa FK506-binding nuclear protein OS=Spodoptera frugiperda GN=FKBP46 PE=2 SV=1 Back     alignment and function description
>sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 Back     alignment and function description
>sp|Q944B0|FK161_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-1, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-1 PE=2 SV=1 Back     alignment and function description
>sp|Q59VR3|FKBP3_CANAL FK506-binding protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FPR3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
359806318241 uncharacterized protein LOC100797411 [Gl 0.734 0.813 0.862 1e-96
224053579202 predicted protein [Populus trichocarpa] 0.737 0.975 0.855 7e-96
225425282257 PREDICTED: probable FKBP-type peptidyl-p 0.749 0.778 0.84 1e-95
449469222257 PREDICTED: peptidyl-prolyl cis-trans iso 0.749 0.778 0.83 3e-94
255543232246 fk506-binding protein, putative [Ricinus 0.726 0.788 0.840 1e-93
357501525240 Peptidyl-prolyl cis-trans isomerase-like 0.820 0.912 0.740 8e-93
15240623256 putative FKBP-type peptidyl-prolyl cis-t 0.790 0.824 0.773 1e-91
356502424242 PREDICTED: probable FKBP-type peptidyl-p 0.835 0.921 0.746 2e-91
297811453256 immunophilin [Arabidopsis lyrata subsp. 0.943 0.984 0.664 3e-91
51968578255 unknown protein [Arabidopsis thaliana] 0.779 0.815 0.775 5e-91
>gi|359806318|ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 184/196 (93%)

Query: 72  ERRRVLISSIGLLAVALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQ 131
           +RR++L+SS  ++A  L + S  GV LAAEFADMPALRGKDYGKTKMRYPDYTETESGLQ
Sbjct: 46  QRRKMLLSSAAIVAGTLCSNSVSGVSLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQ 105

Query: 132 YKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQ 191
           YKDLR G+GPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKD+FKF++G  
Sbjct: 106 YKDLRPGNGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDFFKFKIGYN 165

Query: 192 DVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLI 251
           +VIPAFEEAVSGMALGG+RRIIVPPE+GYPEND+NKSGPRPTTFSGQRALDFVLRNQGLI
Sbjct: 166 EVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLRNQGLI 225

Query: 252 DKTLLFDIELLKIIPN 267
           DKTLLFDIELLKIIPN
Sbjct: 226 DKTLLFDIELLKIIPN 241

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224053579|ref|XP_002297882.1| predicted protein [Populus trichocarpa] gi|222845140|gb|EEE82687.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225425282|ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic isoform 1 [Vitis vinifera] gi|296085536|emb|CBI29268.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469222|ref|XP_004152320.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] gi|449522654|ref|XP_004168341.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255543232|ref|XP_002512679.1| fk506-binding protein, putative [Ricinus communis] gi|223548640|gb|EEF50131.1| fk506-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357501525|ref|XP_003621051.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|355496066|gb|AES77269.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|388505130|gb|AFK40631.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|15240623|ref|NP_196845.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] gi|75335665|sp|Q9LYR5.1|FKB19_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic; Short=PPIase FKBP19; AltName: Full=FK506-binding protein 19; Short=AtFKBP19; AltName: Full=Immunophilin FKBP19; AltName: Full=Rotamase; Flags: Precursor gi|7543908|emb|CAB87148.1| putative protein [Arabidopsis thaliana] gi|46931302|gb|AAT06455.1| At5g13410 [Arabidopsis thaliana] gi|222423171|dbj|BAH19563.1| AT5G13410 [Arabidopsis thaliana] gi|332004508|gb|AED91891.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356502424|ref|XP_003520019.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297811453|ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297319447|gb|EFH49869.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|51968578|dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
TAIR|locus:2181660256 AT5G13410 "AT5G13410" [Arabido 0.790 0.824 0.773 2e-86
UNIPROTKB|Q6ZLL2258 OJ1118_D07.22 "Peptidyl-prolyl 0.438 0.453 0.871 3.2e-79
UNIPROTKB|A8IVN2252 FKB19 "Peptidyl-prolyl cis-tra 0.745 0.789 0.569 5.1e-58
UNIPROTKB|A8JEI4181 FKB16-8 "Peptidyl-prolyl cis-t 0.501 0.740 0.384 1.1e-18
UNIPROTKB|A8I6B6236 FKB16-1 "Peptidyl-prolyl cis-t 0.734 0.830 0.291 2e-15
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.423 0.724 0.367 3.9e-14
TIGR_CMR|GSU_2274156 GSU_2274 "FKBP-type peptidyl-p 0.423 0.724 0.367 3.9e-14
UNIPROTKB|Q6H6D3213 P0669G09.14 "Peptidyl-prolyl c 0.610 0.765 0.322 6.2e-14
UNIPROTKB|Q7NMC5161 glr0841 "Peptidyl-prolyl cis-t 0.471 0.782 0.326 1.7e-13
UNIPROTKB|Q89SJ5154 fbp "Peptidyl-prolyl cis-trans 0.322 0.558 0.360 3.7e-13
TAIR|locus:2181660 AT5G13410 "AT5G13410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 864 (309.2 bits), Expect = 2.0e-86, P = 2.0e-86
 Identities = 164/212 (77%), Positives = 185/212 (87%)

Query:    57 SSYGEISHTSNRQVVERRRVLISSIGLLAVALFNASKDG-VVLAAEFADMPALRGKDYGK 115
             SS G     +N    +RR++L+SS+GLL  AL   SKDG    A++FADMPAL+GKDYGK
Sbjct:    45 SSGGNCGCVNNSGEFDRRKLLVSSVGLLIGALSYDSKDGDFASASQFADMPALKGKDYGK 104

Query:   116 TKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGS 175
             TKM+YPDYTET+SGLQYKDLR G+GP  K G+ VVVDWDGYTIGYYGRIFEARNKTKGGS
Sbjct:   105 TKMKYPDYTETQSGLQYKDLRVGTGPIAKKGDKVVVDWDGYTIGYYGRIFEARNKTKGGS 164

Query:   176 FEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTF 235
             FEGDDK++FKF LGS +VIPAFEEAVSGMALGG+RRIIVPPE+GYP+NDYNKSGPRP TF
Sbjct:   165 FEGDDKEFFKFTLGSNEVIPAFEEAVSGMALGGIRRIIVPPELGYPDNDYNKSGPRPMTF 224

Query:   236 SGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267
             SGQRALDFVLRNQGLIDKTLLFD+ELLKI+PN
Sbjct:   225 SGQRALDFVLRNQGLIDKTLLFDVELLKIVPN 256
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS;IDA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
UNIPROTKB|Q6ZLL2 OJ1118_D07.22 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8IVN2 FKB19 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|A8JEI4 FKB16-8 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|A8I6B6 FKB16-1 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q6H6D3 P0669G09.14 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NMC5 glr0841 "Peptidyl-prolyl cis-trans isomerase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|Q89SJ5 fbp "Peptidyl-prolyl cis-trans isomerase" [Bradyrhizobium japonicum USDA 110 (taxid:224911)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LYR5FKB19_ARATH5, ., 2, ., 1, ., 80.77350.79020.8242yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.I.7980.1
hypothetical protein (202 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.X.2120.1
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (156 aa)
  •     0.406

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 7e-18
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 2e-17
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 2e-09
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 5e-06
COG0544 441 COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans 3e-05
COG1047174 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans 2e-04
PRK01490 435 PRK01490, tig, trigger factor; Provisional 0.001
TIGR00115 408 TIGR00115, tig, trigger factor 0.001
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 79.4 bits (196), Expect = 7e-18
 Identities = 47/143 (32%), Positives = 69/143 (48%), Gaps = 37/143 (25%)

Query: 124 TETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDY 183
               SGLQYK L+ G G  PK G+TV V + G  I   G +F++ +  +G   E      
Sbjct: 97  KTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLID--GTVFDS-SYDRGQPAE------ 147

Query: 184 FKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDF 243
             F LG   VIP ++E + GM +GG R++ +PPE+ Y        G R            
Sbjct: 148 --FPLGG--VIPGWDEGLQGMKVGGKRKLTIPPELAY--------GERGVP--------- 186

Query: 244 VLRNQGLI--DKTLLFDIELLKI 264
                G+I  + TL+F++ELL +
Sbjct: 187 -----GVIPPNSTLVFEVELLDV 204

Length = 205
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|223618 COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234956 PRK01490, tig, trigger factor; Provisional Back     alignment and domain information
>gnl|CDD|232831 TIGR00115, tig, trigger factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 267
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.95
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.93
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.92
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.92
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.91
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.91
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.9
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.9
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.89
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.79
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.48
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.28
PRK01490 435 tig trigger factor; Provisional 99.24
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 99.21
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.68
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 97.71
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.24
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.95  E-value=2.5e-28  Score=209.91  Aligned_cols=127  Identities=37%  Similarity=0.707  Sum_probs=112.8

Q ss_pred             CcccccccccccccCCCceecCCCeEEEEeecCCCCCCCCCCEEEEEEEEEEeccCCeEEeecccCCCCCccCCCCCceE
Q 038431          106 PALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFK  185 (267)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~sGl~~~~l~~G~G~~~~~Gd~V~v~Y~~~~~d~~G~~~dst~~~~~~s~~~~~~~p~~  185 (267)
                      +..+++.|.+.+.+.+.+.++++|++|++++.|+|+.++.+|.|++||++++.|  |++||+       +|+  +++|+.
T Consensus        79 ~~~~~~~f~~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~--G~vFDs-------S~~--rg~p~~  147 (205)
T COG0545          79 NAAEGKAFLEKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLID--GTVFDS-------SYD--RGQPAE  147 (205)
T ss_pred             hHHhHHHHHhhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCC--CCcccc-------ccc--cCCCce
Confidence            444566788878888889999999999999999999999999999999999975  999999       464  478999


Q ss_pred             EecCCCCchHHHHHHHcCCCCCcEEEEEEcCCCCCCCCCCCCCCCCCCCCCCCceeeEeecCCCCCCceEEEEEEEeEEe
Q 038431          186 FRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKII  265 (267)
Q Consensus       186 f~vG~g~~i~GleeaL~gMk~Ge~~~v~IPp~layG~~~~~~~~p~p~~~~g~~~~v~vd~NhplAg~tLvfeVeLl~V~  265 (267)
                      |.+|  ++|+||++||.+|++|++|+++|||++|||.++.+..  ||+                  |++|+|+|||++|.
T Consensus       148 f~l~--~vI~Gw~egl~~M~vG~k~~l~IP~~laYG~~g~~g~--Ipp------------------ns~LvFeVeLl~v~  205 (205)
T COG0545         148 FPLG--GVIPGWDEGLQGMKVGGKRKLTIPPELAYGERGVPGV--IPP------------------NSTLVFEVELLDVK  205 (205)
T ss_pred             eecC--CeeehHHHHHhhCCCCceEEEEeCchhccCcCCCCCC--CCC------------------CCeEEEEEEEEecC
Confidence            9996  9999999999999999999999999999999996553  222                  99999999999984

>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 1e-13
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 2e-13
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 2e-13
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-13
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-13
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-13
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 4e-13
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 7e-13
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 2e-11
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 7e-06
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 8e-06
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 2e-05
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 4e-05
1q6u_A245 Crystal Structure Of Fkpa From Escherichia Coli Len 9e-05
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 1e-04
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-04
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 1e-04
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 2e-04
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 2e-04
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 2e-04
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 2e-04
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 3e-04
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 3e-04
4dip_A125 Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran 4e-04
1q6h_A224 Crystal Structure Of A Truncated Form Of Fkpa From 5e-04
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 6e-04
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 6e-04
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure 
Iteration: 1

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 72/139 (51%), Gaps = 31/139 (22%)
Query: 126 TESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFK 185
           TESGL+Y+DL +GSG + + G+TV V + G+     G+ F++           D  D F 
Sbjct: 6   TESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTD--GQKFDSSK---------DRNDPFA 54
Query: 186 FRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVL 245
           F LG   VI  ++E V GM +GGVRR+ +PP++GY                G R    V+
Sbjct: 55  FVLGGGHVIKGWDEGVQGMKVGGVRRLTIPPQLGY----------------GARGAGGVI 98
Query: 246 RNQGLIDKTLLFDIELLKI 264
                 + TL+F++ELL +
Sbjct: 99  PP----NATLVFEVELLDV 113
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 Back     alignment and structure
>pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 2e-24
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 5e-23
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 7e-23
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 6e-22
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 6e-22
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-21
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-21
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 4e-21
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 4e-21
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 4e-21
1jvw_A167 Macrophage infectivity potentiator; chagas disease 7e-21
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 7e-21
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 3e-20
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 5e-20
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 6e-20
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 6e-20
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-19
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 9e-19
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-18
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-11
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-11
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-18
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 4e-18
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 6e-18
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-17
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 1e-09
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 3e-15
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-14
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-08
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-11
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 2e-07
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 3e-07
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 4e-07
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 5e-06
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 7e-06
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 7e-06
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 1e-05
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 2e-05
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 3e-05
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 3e-05
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 6e-04
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 8e-04
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
 Score = 96.0 bits (239), Expect = 2e-24
 Identities = 53/183 (28%), Positives = 84/183 (45%), Gaps = 41/183 (22%)

Query: 87  ALFNASKDGVVLAAEFADMPALRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMG 146
            L++  +       E  DM      +  + ++       TESGL+Y+DL +GSG + + G
Sbjct: 63  FLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGSTVVTTESGLKYEDLTEGSGAEARAG 122

Query: 147 ETVVVDWDGYTIGYYGRIFEA---RNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSG 203
           +TV V + G+     G+ F++   RN              F F LG   VI  ++E V G
Sbjct: 123 QTVSVHYTGWLTD--GQKFDSSKDRNDP------------FAFVLGGGMVIKGWDEGVQG 168

Query: 204 MALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLI--DKTLLFDIEL 261
           M +GGVRR+ +PP++GY                G R         G+I  + TL+F++EL
Sbjct: 169 MKVGGVRRLTIPPQLGY----------------GARG------AAGVIPPNATLVFEVEL 206

Query: 262 LKI 264
           L +
Sbjct: 207 LDV 209
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Length = 432 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Length = 392 Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.93
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.93
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.93
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.92
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.92
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.92
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.92
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.92
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.92
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.92
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.91
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.91
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.91
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.91
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.91
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.91
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.91
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.91
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.91
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.91
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.9
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.9
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.9
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.9
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.9
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.9
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.9
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.89
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.89
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.88
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.84
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.84
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.84
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.82
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.81
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.79
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.76
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.75
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.55
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.53
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.49
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.14
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 98.36
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
Probab=99.93  E-value=2.1e-26  Score=194.43  Aligned_cols=115  Identities=22%  Similarity=0.252  Sum_probs=95.1

Q ss_pred             CCCCCCEEEEEEEEEEeccCCeEEeecccCCCCCccCCCCCceEEecCCCCchHHHHHHHcCCCCCcEEEEEEcCCCCCC
Q 038431          142 KPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYP  221 (267)
Q Consensus       142 ~~~~Gd~V~v~Y~~~~~d~~G~~~dst~~~~~~s~~~~~~~p~~f~vG~g~~i~GleeaL~gMk~Ge~~~v~IPp~layG  221 (267)
                      .+++||.|+|||++++.  +|++||++       +.  .++|+.|.+|.+++|+|||++|.||++|++++|.|||++|||
T Consensus        24 ~i~~gd~V~v~Y~g~l~--dG~vfDss-------~~--~~~P~~f~lG~g~vipG~eeaL~gm~~Ge~~~v~Ipp~~AYG   92 (169)
T 4dt4_A           24 SVQSNSAVLVHFTLKLD--DGTTAEST-------RN--NGKPALFRLGDASLSEGLEQHLLGLKVGDKTTFSLEPDAAFG   92 (169)
T ss_dssp             SCCTTCEEEEEEEEEET--TSCEEEEH-------HH--HTSCEEEETTSSSSCHHHHHHHTTCCTTCEEEEEECGGGTTC
T ss_pred             cCCCCCEEEEEEEEEEC--CCCEEEec-------CC--CCCCEEEEECCCCccHHHHHHHcCCCCCCEEEEEEChHHhcC
Confidence            58999999999999985  59999995       32  247999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCC------------------CCCCCCcee----------eEeecCCCCCCceEEEEEEEeEEeeC
Q 038431          222 ENDYNKSGPRP------------------TTFSGQRAL----------DFVLRNQGLIDKTLLFDIELLKIIPN  267 (267)
Q Consensus       222 ~~~~~~~~p~p------------------~~~~g~~~~----------v~vd~NhplAg~tLvfeVeLl~V~~~  267 (267)
                      +++...+...|                  .+.+|++..          |+||+||||||++|.|+|+|++|+++
T Consensus        93 ~~~~~lv~~vp~~~f~~~~~~~~G~~~~~~~~~G~~~~~~V~~v~~~~V~vD~NHPLAGk~L~F~vev~~vr~A  166 (169)
T 4dt4_A           93 VPSPDLIQYFSRREFMDAGEPEIGAIMLFTAMDGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPA  166 (169)
T ss_dssp             CCCGGGEEEEEGGGGTTTCCCCTTCEEEEECTTSCEEEEEEEEEETTEEEEECSCTTTTCCEEEEEEEEEESCC
T ss_pred             CCChHHEEEeCHHHCCCcCCCCCCcEEEEECCCCCEEEEEEEEEcCCEEEEeCCCccCCCEEEEEEEEEEEeeC
Confidence            97643222211                  123343221          77999999999999999999999875
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 267
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 4e-17
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-15
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 1e-14
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 3e-14
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 3e-14
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 5e-14
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-13
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 1e-13
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 5e-13
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 2e-12
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 6e-12
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 5e-11
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 2e-09
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 9e-08
d1t11a3113 d.26.1.1 (A:135-247) Trigger factor PPIase domain 7e-04
d1l1pa_106 d.26.1.1 (A:) Trigger factor PPIase domain {Escher 0.003
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 73.4 bits (179), Expect = 4e-17
 Identities = 27/145 (18%), Positives = 45/145 (31%), Gaps = 24/145 (16%)

Query: 122 DYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDK 181
           +++ + SGL + D   G GP+   G+ +   + G                      G  +
Sbjct: 2   EFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGE 61

Query: 182 DYFKFRLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRAL 241
               +     D      + +  M  GG R + +PPE+ Y +      G            
Sbjct: 62  VIKGW-----DQGILGSDGIPPMLTGGKRTLRIPPELAYGDRGAGCKGGSCL-------- 108

Query: 242 DFVLRNQGLI--DKTLLFDIELLKI 264
                    I     LLFDIE +  
Sbjct: 109 ---------IPPASVLLFDIEYIGK 124
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Length = 113 Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.94
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.94
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.93
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.92
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.92
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.92
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.92
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.92
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.91
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.9
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.89
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.84
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.67
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.36
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.28
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]

Probab=99.94  E-value=3.5e-27  Score=202.65  Aligned_cols=127  Identities=28%  Similarity=0.508  Sum_probs=111.1

Q ss_pred             ccccccccccccCCCceecCCCeEEEEeecCCCCCCCCCCEEEEEEEEEEeccCCeEEeecccCCCCCccCCCCCceEEe
Q 038431          108 LRGKDYGKTKMRYPDYTETESGLQYKDLRQGSGPKPKMGETVVVDWDGYTIGYYGRIFEARNKTKGGSFEGDDKDYFKFR  187 (267)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~sGl~~~~l~~G~G~~~~~Gd~V~v~Y~~~~~d~~G~~~dst~~~~~~s~~~~~~~p~~f~  187 (267)
                      ..++.|.+.+.+.+++.++++||+|+++++|+|..+..||.|.|||++++.|  |++|+++       +.  .+.|+.|.
T Consensus        78 ~~~~~fl~~~~~~~~v~~~~sGl~y~v~~~G~G~~p~~~d~v~v~y~g~l~d--g~~f~~s-------~~--~~~p~~~~  146 (204)
T d1fd9a_          78 VKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLID--GTVFDST-------EK--TGKPATFQ  146 (204)
T ss_dssp             HHHHHHHHHHHHSTTEEECTTSCEEEEEECCCSCCCCTTCEEEEEEEEEETT--SCEEEEH-------HH--HCSCEEEE
T ss_pred             HHHHHHHHhcccCCceEEecCccEEEEeecCCCcccCCCCEEEEEEEEEECC--CCEeccc-------cc--CCCCceec
Confidence            3556788877778888999999999999999999999999999999999975  9999995       32  25789888


Q ss_pred             cCCCCchHHHHHHHcCCCCCcEEEEEEcCCCCCCCCCCCCCCCCCCCCCCCceeeEeecCCCCCCceEEEEEEEeEEeeC
Q 038431          188 LGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN  267 (267)
Q Consensus       188 vG~g~~i~GleeaL~gMk~Ge~~~v~IPp~layG~~~~~~~~p~p~~~~g~~~~v~vd~NhplAg~tLvfeVeLl~V~~~  267 (267)
                      +  +++|+||+++|.+|++|++++|+|||++|||.++.+..  +|+                  |++|+|+|||++|+++
T Consensus       147 ~--~~~i~G~~e~l~~m~~G~~~~~~iP~~laYG~~g~~~~--Ipp------------------~s~l~feveL~~i~k~  204 (204)
T d1fd9a_         147 V--SQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGP--IGP------------------NETLIFKIHLISVKKS  204 (204)
T ss_dssp             G--GGSCHHHHHHHTTCCTTCEEEEEECGGGTTTTCCCSSS--CCT------------------TCCEEEEEEEEEEECC
T ss_pred             C--CccchhHHHHhcCCCCCCEEEEEEChHHCcCCCCCCCC--cCc------------------CCcEEEEEEEEEEEcC
Confidence            8  57999999999999999999999999999999986432  332                  8999999999999874
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure