Citrus Sinensis ID: 038439

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MAYGKVKVWCTRQEASVLNIDMKANICCVKYNPGSSNYIAKYQSTAPCVHGHKKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFRGHMNEKNFVGLTVNSEYIACGSESNEVYVYHKEISKPVTWHRFSSPDMDDTDEDAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA

cccccEEEEEcccccEEEcccccccEEEEEEcccccccEEEccccccccccccccEEEEEEcccccEEEccccccEEEEEccccCEEEEEccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEEcccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEccc

MAYGKVKVWCTRQEASVLNIDMKANICCVKYNPGSSNYIAKYQSTAPCVHGHKKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFRGHMNEKNFVGLTVNSEYIACGSESNEVYVYHKEISKPVTWHRFSSPDM**TDEDAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAYGKVKVWCTRQEASVLNIDMKANICCVKYNPGSSNYIAKYQSTAPCVHGHKKAVSYVKFLSNDELASASTDSTLRLWDVKENLPVRTFRGHMNEKNFVGLTVNSEYIACGSESNEVYVYHKEISKPVTWHRFSSPDMDDTDEDAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase COP1	E3 ubiquitin-protein ligase that acts as a repressor of photomorphogenesis and as an activator of etiolation in darkness. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Represses photomorphogenesis in darkness by mediating ubiquitination and subsequent proteasomal degradation of light-induced transcription factors such as HY5, HYH and LAF1. Down-regulates MYB21, probably via ubiquitination process. Light stimuli abrogate the repression of photomorphogenesis, possibly due to its localization to the cytoplasm. Could play a role in switching between skotomorphogenetic and photomorphogenetic pathways.	probable	P43254

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 1-137,148-179
View the alignment between query and template
View the model in PyMOL