Citrus Sinensis ID: 038498

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MAARKQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKTVIDEYDYVFSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKCKALFLAKP
cccccccEEEEEEcccccccccccccHHHHHHHHHHHcccEEEEEEcccHHHHHHHHcccccccccEEEcccccEEECcccCEEEEcccccccHHHHHHHHHHHHHHHHccccccccccEEEEccccEEEccccccccHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEEcccEEEEEECcccccHHHHHHHcccccEEEEccccccccccccccccccCEEEECccHHHHHHHHHHHccccc
****KQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKTVIDEYDYVFSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKCKALFLAK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARKQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKTVIDEYDYVFSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKCKALFLAKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphomannomutase Involved in ascorbic acid biosynthesis and in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.confidentQ7XPW5
Phosphomannomutase Involved in ascorbic acid biosynthesis and in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.confidentQ1W376
Phosphomannomutase Involved in ascorbic acid biosynthesis and in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.confidentO80840

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.4.-.-Intramolecular transferases (mutases).probable
5.4.2.-Phosphotransferases (phosphomutases).probable
5.4.2.8Transferred entry: 5.4.2.8.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AMY, chain A
Confidence level:very confident
Coverage over the Query: 5-245
View the alignment between query and template
View the model in PyMOL