Citrus Sinensis ID: 038498
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| 225454105 | 249 | PREDICTED: phosphomannomutase isoform 2 | 0.995 | 0.991 | 0.910 | 1e-132 | |
| 147856872 | 249 | hypothetical protein VITISV_006228 [Viti | 0.995 | 0.991 | 0.910 | 1e-131 | |
| 118488485 | 246 | unknown [Populus trichocarpa] | 0.991 | 1.0 | 0.906 | 1e-131 | |
| 224127594 | 246 | predicted protein [Populus trichocarpa] | 0.991 | 1.0 | 0.890 | 1e-128 | |
| 242074812 | 249 | hypothetical protein SORBIDRAFT_06g03328 | 0.991 | 0.987 | 0.849 | 1e-124 | |
| 226530195 | 249 | uncharacterized protein LOC100272867 [Ze | 0.991 | 0.987 | 0.849 | 1e-124 | |
| 257071836 | 251 | phosphomannomutase D2 [Triticum aestivum | 0.991 | 0.980 | 0.846 | 1e-124 | |
| 122194124 | 249 | RecName: Full=Phosphomannomutase; AltNam | 0.991 | 0.987 | 0.850 | 1e-124 | |
| 115461390 | 248 | Os04g0682300 [Oryza sativa Japonica Grou | 0.995 | 0.995 | 0.846 | 1e-124 | |
| 224549860 | 248 | phosphomannomutase [Malpighia glabra] | 0.991 | 0.991 | 0.902 | 1e-123 |
| >gi|225454105|ref|XP_002267677.1| PREDICTED: phosphomannomutase isoform 2 [Vitis vinifera] gi|297745223|emb|CBI40303.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 475 bits (1223), Expect = e-132, Method: Compositional matrix adjust.
Identities = 225/247 (91%), Positives = 238/247 (96%)
Query: 1 MAARKQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKT 60
MAARK GL+ALFDVDGTLTAPRK ATPQMLEFMR+LRKV+TVGVVGGSDL KISEQLG +
Sbjct: 1 MAARKAGLIALFDVDGTLTAPRKVATPQMLEFMRKLRKVITVGVVGGSDLVKISEQLGSS 60
Query: 61 VIDEYDYVFSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTF 120
VID+YDYVFSENGLVAHKDGKLIGTQSLK+FLG EKLKE INFTLHYIADLDIPIKRGTF
Sbjct: 61 VIDDYDYVFSENGLVAHKDGKLIGTQSLKTFLGEEKLKEIINFTLHYIADLDIPIKRGTF 120
Query: 121 IEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQIS 180
IEFRSGMLN+SPIGRNCSQEERDEFE+YDKIHNIRPKMVSVLREKFAHLNLTFSIGGQIS
Sbjct: 121 IEFRSGMLNVSPIGRNCSQEERDEFEKYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQIS 180
Query: 181 FDVFPQGWDKTYCLRYLDDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKC 240
FDVFPQGWDKTYCLRYLDDF EIHFFGDKTY+ GNDHEI+ESERTVGHTVTSP+DT+E+C
Sbjct: 181 FDVFPQGWDKTYCLRYLDDFPEIHFFGDKTYEAGNDHEIYESERTVGHTVTSPDDTVEQC 240
Query: 241 KALFLAK 247
ALFLAK
Sbjct: 241 TALFLAK 247
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147856872|emb|CAN81334.1| hypothetical protein VITISV_006228 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|118488485|gb|ABK96056.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224127594|ref|XP_002320113.1| predicted protein [Populus trichocarpa] gi|222860886|gb|EEE98428.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|242074812|ref|XP_002447342.1| hypothetical protein SORBIDRAFT_06g033280 [Sorghum bicolor] gi|241938525|gb|EES11670.1| hypothetical protein SORBIDRAFT_06g033280 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|226530195|ref|NP_001140792.1| uncharacterized protein LOC100272867 [Zea mays] gi|194701096|gb|ACF84632.1| unknown [Zea mays] gi|194701110|gb|ACF84639.1| unknown [Zea mays] gi|223947667|gb|ACN27917.1| unknown [Zea mays] gi|238009672|gb|ACR35871.1| unknown [Zea mays] gi|414584724|tpg|DAA35295.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584725|tpg|DAA35296.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584726|tpg|DAA35297.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584727|tpg|DAA35298.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] gi|414584728|tpg|DAA35299.1| TPA: hypothetical protein ZEAMMB73_474117 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|257071836|gb|ACV41080.1| phosphomannomutase D2 [Triticum aestivum] gi|257071850|gb|ACV41086.1| phosphomannomutase D2 [Aegilops tauschii] | Back alignment and taxonomy information |
|---|
| >gi|122194124|sp|Q1W374.1|PMM_WHEAT RecName: Full=Phosphomannomutase; AltName: Full=TaPMM gi|90762172|gb|ABD97875.1| phosphomannomutase [Triticum aestivum] gi|257071827|gb|ACV41076.1| phosphomannomutase A1 [Triticum aestivum] gi|257071845|gb|ACV41084.1| phosphomannomutase A1 [Triticum urartu] gi|410832832|gb|AFV92897.1| phosphomannomutase A1 [Triticum monococcum] | Back alignment and taxonomy information |
|---|
| >gi|115461390|ref|NP_001054295.1| Os04g0682300 [Oryza sativa Japonica Group] gi|75143801|sp|Q7XPW5.2|PMM_ORYSJ RecName: Full=Phosphomannomutase; Short=OsPMM gi|122195780|sp|Q259G4.1|PMM_ORYSI RecName: Full=Phosphomannomutase; Short=OsPMM gi|38345559|emb|CAE03433.2| OSJNBa0032F06.16 [Oryza sativa Japonica Group] gi|90399073|emb|CAJ86295.1| H0124B04.12 [Oryza sativa Indica Group] gi|90762125|gb|ABD97871.1| phosphomannomutase [Oryza sativa Japonica Group] gi|113565866|dbj|BAF16209.1| Os04g0682300 [Oryza sativa Japonica Group] gi|125592104|gb|EAZ32454.1| hypothetical protein OsJ_16666 [Oryza sativa Japonica Group] gi|215678937|dbj|BAG96367.1| unnamed protein product [Oryza sativa Japonica Group] gi|215692473|dbj|BAG87893.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|224549860|gb|ACN54046.1| phosphomannomutase [Malpighia glabra] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 248 | ||||||
| TAIR|locus:2050751 | 246 | PMM "phosphomannomutase" [Arab | 0.991 | 1.0 | 0.817 | 5.3e-111 | |
| DICTYBASE|DDB_G0279289 | 249 | pmmA "phosphomannomutase" [Dic | 0.951 | 0.947 | 0.644 | 4.1e-81 | |
| POMBASE|SPAC1556.07 | 257 | pmm1 "phosphomannomutase Pmm1" | 0.951 | 0.918 | 0.630 | 2.9e-80 | |
| DICTYBASE|DDB_G0272781 | 249 | pmmB "phosphomannomutase B" [D | 0.987 | 0.983 | 0.588 | 2.1e-77 | |
| UNIPROTKB|O15305 | 246 | PMM2 "Phosphomannomutase 2" [H | 0.951 | 0.959 | 0.613 | 7.1e-77 | |
| UNIPROTKB|F1N8Z6 | 251 | PMM2 "Uncharacterized protein" | 0.983 | 0.972 | 0.605 | 1.5e-76 | |
| UNIPROTKB|E1C4B8 | 249 | PMM2 "Uncharacterized protein" | 0.983 | 0.979 | 0.604 | 5e-76 | |
| UNIPROTKB|E2R832 | 251 | PMM2 "Uncharacterized protein" | 0.979 | 0.968 | 0.601 | 1.3e-75 | |
| MGI|MGI:1859214 | 242 | Pmm2 "phosphomannomutase 2" [M | 0.951 | 0.975 | 0.605 | 1.3e-75 | |
| RGD|1309366 | 242 | Pmm2 "phosphomannomutase 2" [R | 0.951 | 0.975 | 0.609 | 1.7e-75 |
| TAIR|locus:2050751 PMM "phosphomannomutase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1096 (390.9 bits), Expect = 5.3e-111, P = 5.3e-111
Identities = 201/246 (81%), Positives = 231/246 (93%)
Query: 1 MAARKQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKT 60
MAA+ G++ALFDVDGTLTAPRK ATP++L+F+RELRKVVT+GVVGGSDLSKISEQLGKT
Sbjct: 1 MAAKIPGVIALFDVDGTLTAPRKEATPELLDFIRELRKVVTIGVVGGSDLSKISEQLGKT 60
Query: 61 VIDEYDYVFSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTF 120
V ++YDY FSENGLVAHKDGK IG QSLK LG +KLKE INFTLHYIADLDIPIKRGTF
Sbjct: 61 VTNDYDYCFSENGLVAHKDGKSIGIQSLKLHLGDDKLKELINFTLHYIADLDIPIKRGTF 120
Query: 121 IEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQIS 180
IEFR+GMLN+SPIGRNCSQEERDEFERYDK+ NIRPKMV+ LRE+FAHLNLTFSIGGQIS
Sbjct: 121 IEFRNGMLNVSPIGRNCSQEERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQIS 180
Query: 181 FDVFPQGWDKTYCLRYLDDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKC 240
FDVFP+GWDKTYCL+YL+DF+EIHFFGDKTY+GGND+EI+ES +T+GH+VTSP+DT+ KC
Sbjct: 181 FDVFPKGWDKTYCLQYLEDFSEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTVAKC 240
Query: 241 KALFLA 246
KALF++
Sbjct: 241 KALFMS 246
|
|
| DICTYBASE|DDB_G0279289 pmmA "phosphomannomutase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1556.07 pmm1 "phosphomannomutase Pmm1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272781 pmmB "phosphomannomutase B" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O15305 PMM2 "Phosphomannomutase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N8Z6 PMM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C4B8 PMM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R832 PMM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1859214 Pmm2 "phosphomannomutase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309366 Pmm2 "phosphomannomutase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00026780001 | SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (249 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00038234001 | • | • | • | 0.982 | |||||||
| GSVIVG00018410001 | • | • | • | 0.973 | |||||||
| GSVIVG00014427001 | • | • | 0.916 | ||||||||
| GSVIVG00016656001 | • | • | 0.914 | ||||||||
| GSVIVG00034293001 | • | • | 0.914 | ||||||||
| GSVIVG00022229001 | • | • | 0.911 | ||||||||
| GSVIVG00010644001 | • | 0.899 | |||||||||
| GSVIVG00001918001 | • | • | 0.599 | ||||||||
| GSVIVG00015572001 | • | • | 0.531 | ||||||||
| GSVIVG00025575001 | • | 0.483 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 248 | |||
| PLN02423 | 245 | PLN02423, PLN02423, phosphomannomutase | 0.0 | |
| PTZ00174 | 247 | PTZ00174, PTZ00174, phosphomannomutase; Provisiona | 1e-153 | |
| pfam03332 | 219 | pfam03332, PMM, Eukaryotic phosphomannomutase | 1e-138 | |
| COG0561 | 264 | COG0561, Cof, Predicted hydrolases of the HAD supe | 3e-26 | |
| TIGR01484 | 204 | TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, | 1e-21 | |
| pfam08282 | 254 | pfam08282, Hydrolase_3, haloacid dehalogenase-like | 7e-06 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 1e-05 | |
| TIGR00099 | 256 | TIGR00099, Cof-subfamily, Cof subfamily of IIB sub | 0.001 |
| >gnl|CDD|178043 PLN02423, PLN02423, phosphomannomutase | Back alignment and domain information |
|---|
Score = 520 bits (1340), Expect = 0.0
Identities = 221/245 (90%), Positives = 240/245 (97%)
Query: 1 MAARKQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKT 60
MAARK G++ALFDVDGTLTAPRK ATP+MLEFM+ELRKVVTVGVVGGSDLSKISEQLGKT
Sbjct: 1 MAARKPGVIALFDVDGTLTAPRKEATPEMLEFMKELRKVVTVGVVGGSDLSKISEQLGKT 60
Query: 61 VIDEYDYVFSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTF 120
VI++YDYVFSENGLVAHKDGKLIGTQSLKSFLG +KLKEFINFTLHYIADLDIPIKRGTF
Sbjct: 61 VINDYDYVFSENGLVAHKDGKLIGTQSLKSFLGEDKLKEFINFTLHYIADLDIPIKRGTF 120
Query: 121 IEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQIS 180
IEFRSGMLN+SPIGRNCSQEERDEFE+YDK+HNIRPKMVSVLREKFAHLNLT+SIGGQIS
Sbjct: 121 IEFRSGMLNVSPIGRNCSQEERDEFEKYDKVHNIRPKMVSVLREKFAHLNLTYSIGGQIS 180
Query: 181 FDVFPQGWDKTYCLRYLDDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKC 240
FDVFPQGWDKTYCL++L+DF+EIHFFGDKTY+GGNDHEIFESERT+GHTVTSP+DT E+C
Sbjct: 181 FDVFPQGWDKTYCLQFLEDFDEIHFFGDKTYEGGNDHEIFESERTIGHTVTSPDDTREQC 240
Query: 241 KALFL 245
ALFL
Sbjct: 241 TALFL 245
|
Length = 245 |
| >gnl|CDD|240305 PTZ00174, PTZ00174, phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202597 pfam03332, PMM, Eukaryotic phosphomannomutase | Back alignment and domain information |
|---|
| >gnl|CDD|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233434 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >gnl|CDD|219777 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|232824 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| PTZ00174 | 247 | phosphomannomutase; Provisional | 100.0 | |
| PLN02423 | 245 | phosphomannomutase | 100.0 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 100.0 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 100.0 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 100.0 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 100.0 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 100.0 | |
| PLN02887 | 580 | hydrolase family protein | 100.0 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 100.0 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 100.0 | |
| PF03332 | 220 | PMM: Eukaryotic phosphomannomutase; InterPro: IPR0 | 100.0 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 100.0 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 100.0 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 100.0 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 100.0 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.97 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.97 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 99.97 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.96 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.96 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 99.96 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 99.96 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.95 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 99.94 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 99.94 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 99.94 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.93 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 99.91 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 99.9 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.89 | |
| PLN02580 | 384 | trehalose-phosphatase | 99.87 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 99.85 | |
| PLN03017 | 366 | trehalose-phosphatase | 99.84 | |
| PLN02151 | 354 | trehalose-phosphatase | 99.79 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 99.78 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 99.73 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 99.68 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 99.68 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 99.61 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.48 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.41 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.41 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.39 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 99.35 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 99.28 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 99.25 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 99.03 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.0 | |
| KOG1050 | 732 | consensus Trehalose-6-phosphate synthase component | 98.98 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.97 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.94 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 98.91 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.82 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 98.76 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 98.7 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 98.7 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 98.7 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 98.68 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.67 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 98.67 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.66 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 98.64 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 98.6 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.58 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 98.56 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 98.54 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.53 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 98.53 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 98.49 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.48 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 98.47 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 98.47 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 98.46 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 98.35 | |
| PLN02954 | 224 | phosphoserine phosphatase | 98.33 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 98.33 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 98.3 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.26 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 98.24 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 98.22 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 98.21 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 98.21 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 98.17 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 98.17 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 98.16 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 98.15 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 98.11 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.08 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 98.02 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 98.0 | |
| PLN02940 | 382 | riboflavin kinase | 98.0 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.96 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 97.95 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.94 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 97.94 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.93 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 97.81 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 97.74 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.72 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 97.7 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 97.65 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 97.65 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 97.57 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 97.54 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.5 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.49 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 97.47 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 97.44 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.43 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 97.41 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 97.37 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 97.34 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 97.32 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 97.28 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.28 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 97.23 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.23 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 97.21 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 97.2 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.17 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 97.13 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.12 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 97.11 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 97.11 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 97.07 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 97.07 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 97.06 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 97.06 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.05 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 97.02 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 97.01 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 96.99 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.98 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 96.95 | |
| PRK06769 | 173 | hypothetical protein; Validated | 96.93 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 96.93 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 96.92 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 96.89 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 96.88 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 96.85 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 96.82 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 96.81 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 96.81 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 96.75 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 96.69 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 96.66 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 96.59 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 96.58 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 96.48 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 96.4 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 96.35 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 96.34 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 96.32 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 96.31 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.29 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 96.14 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 96.11 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 96.1 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 96.05 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 96.04 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 95.87 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 95.86 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 95.83 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 95.81 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 95.73 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 95.72 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 95.66 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 95.32 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 95.28 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 95.27 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 95.12 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 95.08 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 94.89 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 94.7 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 94.61 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 94.55 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 94.48 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 94.47 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 94.06 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 93.74 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 93.68 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 93.61 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 93.28 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 93.22 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 92.9 | |
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 92.73 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 92.68 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 92.43 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 92.27 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 91.76 | |
| PLN02811 | 220 | hydrolase | 91.53 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 91.41 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 91.2 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 90.81 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 90.73 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 90.59 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 90.59 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 90.5 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 90.0 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 89.17 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 89.16 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 88.95 | |
| KOG0205 | 942 | consensus Plasma membrane H+-transporting ATPase [ | 88.4 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 87.8 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 87.68 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 87.61 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 87.43 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 87.4 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 87.0 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 86.95 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 86.78 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 86.5 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 86.09 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 85.93 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 85.76 | |
| PRK06769 | 173 | hypothetical protein; Validated | 85.73 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 84.84 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 84.8 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 84.61 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 84.28 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 84.0 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 83.07 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 82.65 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 82.4 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 82.18 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 82.06 | |
| PLN02499 | 498 | glycerol-3-phosphate acyltransferase | 81.85 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 80.41 |
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-41 Score=280.33 Aligned_cols=244 Identities=64% Similarity=1.111 Sum_probs=179.5
Q ss_pred cccceEEEEecCCCCCCCCCCCCHHHHHHHHHHhhc-CeEEEEcCCChHHHHHHhcccccCCCceEEecCCcEEEeCCcE
Q 038498 4 RKQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKV-VTVGVVGGSDLSKISEQLGKTVIDEYDYVFSENGLVAHKDGKL 82 (248)
Q Consensus 4 ~~~~kli~~DlDGTLl~~~~~i~~~~~~al~~l~~~-~~v~iaTGR~~~~~~~~l~~~~~~~~~~~i~~nGa~i~~~~~~ 82 (248)
++++|+|++||||||+++++.++++++++|++++++ +.|++||||++..+.+.++......++++|+.||+.++++++.
T Consensus 2 ~~~~klia~DlDGTLL~~~~~is~~~~~ai~~l~~~Gi~~viaTGR~~~~i~~~l~~~~~~~~~~~I~~NGa~I~~~~~~ 81 (247)
T PTZ00174 2 EMKKTILLFDVDGTLTKPRNPITQEMKDTLAKLKSKGFKIGVVGGSDYPKIKEQLGEDVLEDFDYVFSENGLVAYKDGEL 81 (247)
T ss_pred CCCCeEEEEECcCCCcCCCCCCCHHHHHHHHHHHHCCCEEEEEcCCCHHHHHHHHhhhhhcccCeEEeCCceEEEECCeE
Confidence 357899999999999999999999999999999999 9999999999999988887421123458999999999988888
Q ss_pred EEEeecccccchHHHHHHHHHHHHhhccccccccccccceeccccceecccCCCCChhhhhhhhhccccccchHHHHHHH
Q 038498 83 IGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVL 162 (248)
Q Consensus 83 i~~~~~~~~i~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l 162 (248)
++...++..++.+.+.++++.+.++.....+....+.|........++.+............+..+.......+++.+.+
T Consensus 82 i~~~~i~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l 161 (247)
T PTZ00174 82 FHSQSILKFLGEEKLKKFINFCLRYIADLDIPVKRGTFIEYRNGMINISPIGRNCSQEERDEFEKYDKEHHIREKFIQDL 161 (247)
T ss_pred EEEEcchhcCCHHHHHHHHHHHHHHHHhcCCccceeeeEEcCCceEEeccccccCCHHHHHHHHhcCCcchHHHHHHHHH
Confidence 98888754467788999998887653222222233444433221222222211111111111211211122334566677
Q ss_pred HHHcCCceEEEEecCceEEEEeeCCCCHHHHHHHhhc-cCCEEEEcCCCCCCCCCHHHHhhCCCceEEccCchhhHHHHh
Q 038498 163 REKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDD-FNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKCK 241 (248)
Q Consensus 163 ~~~~~~~~~~~~~~~~~~~di~~~~~~K~~al~~l~~-~~~~~aiGD~~~~~~NDi~M~~~~g~~~~av~Na~~~~k~~A 241 (248)
.+.++++.+.++.+++.++||+|+++|||.||++|++ .++++||||+++.+.||++||+.+++.|++|+||+|.+|.+|
T Consensus 162 ~~~~~~~~~~~s~~~~~~leI~~~gvsKg~al~~L~~~~~eviafGD~~~~~~NDieMl~~~~~~g~~v~n~~~~~~~~~ 241 (247)
T PTZ00174 162 KKEFSDLGLKFSIGGQISFDVFPKGWDKTYCLRHLENDFKEIHFFGDKTFEGGNDYEIYNDPRTIGHSVKNPEDTIKILK 241 (247)
T ss_pred HHhcCCCCeEEEecCceEEEeeeCCCcHHHHHHHHHhhhhhEEEEcccCCCCCCcHhhhhcCCCceEEeCCHHHHHHHHH
Confidence 7777766666665456899999999999999999998 899999999666668999999988667899999999999999
Q ss_pred hhhccC
Q 038498 242 ALFLAK 247 (248)
Q Consensus 242 ~~v~~~ 247 (248)
+.++++
T Consensus 242 ~~~~~~ 247 (247)
T PTZ00174 242 ELFLKK 247 (247)
T ss_pred HHhcCC
Confidence 999875
|
|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF03332 PMM: Eukaryotic phosphomannomutase; InterPro: IPR005002 This enzyme (5 | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PLN02499 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 248 | ||||
| 2amy_A | 246 | X-Ray Structure Of Human Phosphomannomutase 2 (Pmm2 | 2e-81 | ||
| 2i54_A | 247 | Phosphomannomutase From Leishmania Mexicana Length | 2e-76 | ||
| 3f9r_A | 246 | Crystal Structure Of Trypanosoma Brucei Phosphomann | 6e-76 | ||
| 2fuc_A | 262 | Human Alpha-Phosphomannomutase 1 With Mg2+ Cofactor | 3e-75 |
| >pdb|2AMY|A Chain A, X-Ray Structure Of Human Phosphomannomutase 2 (Pmm2) Length = 246 | Back alignment and structure |
|
| >pdb|2I54|A Chain A, Phosphomannomutase From Leishmania Mexicana Length = 247 | Back alignment and structure |
| >pdb|3F9R|A Chain A, Crystal Structure Of Trypanosoma Brucei Phosphomannosemutase, Tb.10.700.370 Length = 246 | Back alignment and structure |
| >pdb|2FUC|A Chain A, Human Alpha-Phosphomannomutase 1 With Mg2+ Cofactor Bound Length = 262 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 248 | |||
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 8e-76 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 3e-75 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 1e-73 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 5e-07 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 3e-06 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 7e-06 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 1e-04 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 1e-04 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 2e-04 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 4e-04 |
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Length = 246 | Back alignment and structure |
|---|
Score = 229 bits (583), Expect = 8e-76
Identities = 147/245 (60%), Positives = 187/245 (76%), Gaps = 2/245 (0%)
Query: 2 AARKQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKTV 61
+A L LFDVDGTLTAPR+ T +M +F+++LR+ + +GVVGGSD K+ EQLG V
Sbjct: 1 SAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDV 60
Query: 62 IDEYDYVFSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFI 121
+++YDYVF ENGLVA+KDGKL+ Q+++S LG +++ IN+ L YIA + +P KRGTFI
Sbjct: 61 VEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFI 120
Query: 122 EFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQISF 181
EFR+GMLN+SPIGR+CSQEER EF DK NIR K V+ LR++FA LTFSIGGQISF
Sbjct: 121 EFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISF 180
Query: 182 DVFPQGWDKTYCLRYL--DDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEK 239
DVFP GWDK YCLR++ D + I+FFGDKT GGNDHEIF RT+G++VT+PEDT
Sbjct: 181 DVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRI 240
Query: 240 CKALF 244
C+ LF
Sbjct: 241 CELLF 245
|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Length = 262 | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} PDB: 2i54_A* 2i55_A* Length = 246 | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Length = 289 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Length = 258 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Length = 244 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Length = 261 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} Length = 268 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Length = 227 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} Length = 274 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 100.0 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 100.0 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 100.0 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 100.0 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 100.0 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 100.0 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 100.0 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 100.0 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 100.0 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 100.0 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 100.0 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 100.0 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 100.0 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 100.0 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 100.0 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 100.0 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 100.0 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 99.98 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 99.97 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.97 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.97 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.97 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.97 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.96 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.96 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.92 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 99.78 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.72 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.71 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 99.65 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.64 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 99.61 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.61 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.57 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.57 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.54 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.53 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.53 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.52 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.51 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.5 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.5 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.49 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.49 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.49 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.45 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.45 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.43 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.42 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.42 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.4 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.36 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.35 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.33 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.33 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.32 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.32 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.3 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.29 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.26 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.24 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.23 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.22 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.22 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.21 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.21 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.2 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.2 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 99.19 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.19 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.18 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.17 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.16 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.16 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.16 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.15 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.14 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.14 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.13 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.12 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.12 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.12 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.12 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.11 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.09 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.08 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.07 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.07 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.05 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 99.04 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.03 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.01 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.0 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.95 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 98.91 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 98.91 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.89 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 98.87 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 98.86 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 98.84 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 98.84 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.79 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 98.78 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 98.77 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 98.73 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 98.72 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.71 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.69 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.62 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 98.61 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 98.6 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 98.6 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 98.59 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.58 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 98.52 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.51 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 98.49 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.48 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 98.46 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 98.36 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 98.32 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 98.3 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 98.22 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 98.18 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.15 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 98.07 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 98.02 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 98.0 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 97.97 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 97.97 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 97.94 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 97.91 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.87 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 97.81 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.78 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.58 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 97.55 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.46 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 97.42 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 96.45 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 97.32 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 97.2 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 97.12 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 96.74 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 96.51 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 96.46 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 96.45 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 96.41 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 96.29 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 96.23 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.17 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 95.86 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 95.84 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 95.42 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 95.42 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 94.76 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 94.73 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 94.6 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 94.54 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 94.34 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 94.25 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 94.21 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 93.78 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 92.96 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 92.89 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 92.77 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 91.76 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 91.45 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 88.42 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 88.16 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 88.08 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 85.27 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 84.86 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 84.71 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 83.35 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 80.53 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 80.24 |
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-41 Score=278.58 Aligned_cols=241 Identities=54% Similarity=0.977 Sum_probs=185.1
Q ss_pred ccceEEEEecCCCCCCCCCCCCHHHHHHHHHHhhc-CeEEEEcCCChHHHHHHhcccccCCCceEEecCCcEEEeCCcEE
Q 038498 5 KQGLLALFDVDGTLTAPRKAATPQMLEFMRELRKV-VTVGVVGGSDLSKISEQLGKTVIDEYDYVFSENGLVAHKDGKLI 83 (248)
Q Consensus 5 ~~~kli~~DlDGTLl~~~~~i~~~~~~al~~l~~~-~~v~iaTGR~~~~~~~~l~~~~~~~~~~~i~~nGa~i~~~~~~i 83 (248)
+++|+|+|||||||+++++.++++++++|++|+++ +.|++||||++..+.+.++..+...++++|+.||+.+++.++.+
T Consensus 2 M~~kli~~DlDGTLl~~~~~i~~~~~~~l~~l~~~g~~~~iaTGR~~~~~~~~l~~~~~~~~~~~i~~NGa~i~~~~~~i 81 (246)
T 3f9r_A 2 MKRVLLLFDVDGTLTPPRLCQTDEMRALIKRARGAGFCVGTVGGSDFAKQVEQLGRDVLTQFDYVFAENGLLAYRNGLEI 81 (246)
T ss_dssp CCSEEEEECSBTTTBSTTSCCCHHHHHHHHHHHHTTCEEEEECSSCHHHHHHHHCTTHHHHCSEEEEGGGTEEEETTEEE
T ss_pred CCceEEEEeCcCCcCCCCCccCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHhhhhccccCCEEEECCCcEEEECCEEE
Confidence 36899999999999999999999999999999999 99999999999999888884211235799999999999999999
Q ss_pred EEeecccccchHHHHHHHHHHHHhhccccccccccccceeccccceecccCCCCChhhhhhhhhccccccchHHHHHHHH
Q 038498 84 GTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLR 163 (248)
Q Consensus 84 ~~~~~~~~i~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ 163 (248)
+...++..++.+.++++++.+.++.....++..++.|.+.+....++.+.........+..+..++......+.+.+.+.
T Consensus 82 ~~~~i~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ 161 (246)
T 3f9r_A 82 HRQSLLNALGNDRIVKFVKKTLRLIADLDIPVQRGTFVEYRNGMINVSPIGRNCSQAERDEFEVYDNEHRVRASLIAELE 161 (246)
T ss_dssp EECCHHHHTCHHHHHHHHHHHHHHHHTCCCSCCCSCCEEECSSCEEECSSCTTSCHHHHHHHHHHHHHHCHHHHHHHHHH
T ss_pred EEeeccccCCHHHHHHHHHHHHhhhhceeeecCCceEEEeecceeccccccccCchhhceeeeEecccchHHHHHHHHHH
Confidence 98876433568899999999888755544544566777655544444444333322222122222222223456677888
Q ss_pred HHcCCceEEEEecCceEEEEeeCCCCHHHHHHHhhc-cCCEEEEcCCCCCCCCCHHHHhhCCCceEEccCchhhHHHHhh
Q 038498 164 EKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDD-FNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKCKA 242 (248)
Q Consensus 164 ~~~~~~~~~~~~~~~~~~di~~~~~~K~~al~~l~~-~~~~~aiGD~~~~~~NDi~M~~~~g~~~~av~Na~~~~k~~A~ 242 (248)
+.+++..+.+..+++.++||+|+++|||.||++|++ +++++||||.++++.||++||+.+|..+++|+||.+.+|.++.
T Consensus 162 ~~~~~~~~~~~~sg~~~leI~~~gv~Kg~al~~L~~~~~ev~afGD~~~~g~NDi~Ml~~a~~~g~~v~n~~~~~~~~~~ 241 (246)
T 3f9r_A 162 NSFPDFGLKYSIGGQISFDVFPVGWDKTYCLQFVEDDFEEIHFFGDKTQEGGNDYEIYTDKRTIGHKVTSYKDTIAEVEK 241 (246)
T ss_dssp HHCGGGCEEEEEETTTEEEEEETTCSGGGGGGGTTTTCSEEEEEESCCSTTSTTHHHHTCTTSEEEECSSHHHHHHHHHH
T ss_pred hhCcCCcEEEEecCCeEEEEEeCCCCHHHHHHHHHcCcccEEEEeCCCCCCCCCHHHHhCCCccEEEeCCHHHHHHHHHH
Confidence 888764344344488999999999999999999997 8899999994444499999999986579999999999999998
Q ss_pred hhc
Q 038498 243 LFL 245 (248)
Q Consensus 243 ~v~ 245 (248)
.+.
T Consensus 242 ~~~ 244 (246)
T 3f9r_A 242 IIA 244 (246)
T ss_dssp HHH
T ss_pred Hhc
Confidence 764
|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 248 | ||||
| d2amya1 | 243 | c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( | 2e-47 | |
| d2fuea1 | 244 | c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human | 3e-43 | |
| d1u02a_ | 229 | c.108.1.15 (A:) Trehalose-6-phosphate phosphatase | 8e-14 | |
| d1nrwa_ | 285 | c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu | 4e-09 | |
| d1rkqa_ | 271 | c.108.1.10 (A:) Hypothetical protein YidA {Escheri | 1e-08 | |
| d1nf2a_ | 267 | c.108.1.10 (A:) Hypothetical protein TM0651 {Therm | 1e-08 | |
| d2b30a1 | 283 | c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod | 5e-07 | |
| d2rbka1 | 260 | c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B | 7e-07 | |
| d1xvia_ | 232 | c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera | 2e-06 | |
| d1s2oa1 | 244 | c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 { | 5e-06 | |
| d1rlma_ | 269 | c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc | 1e-04 | |
| d1l6ra_ | 225 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 1e-04 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 0.001 | |
| d1wzca1 | 243 | c.108.1.10 (A:1-243) Putative mannosyl-3-phosphogl | 0.001 |
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Predicted hydrolases Cof domain: Phosphomannomutase 2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 155 bits (392), Expect = 2e-47
Identities = 146/238 (61%), Positives = 185/238 (77%), Gaps = 2/238 (0%)
Query: 9 LALFDVDGTLTAPRKAATPQMLEFMRELRKVVTVGVVGGSDLSKISEQLGKTVIDEYDYV 68
L LFDVDGTLTAPR+ T +M +F+++LR+ + +GVVGGSD K+ EQLG V+++YDYV
Sbjct: 5 LCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYV 64
Query: 69 FSENGLVAHKDGKLIGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGML 128
F ENGLVA+KDGKL+ Q+++S LG +++ IN+ L YIA + +P KRGTFIEFR+GML
Sbjct: 65 FPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGML 124
Query: 129 NISPIGRNCSQEERDEFERYDKIHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGW 188
N+SPIGR+CSQEER EF DK NIR K V+ LR++FA LTFSIGGQISFDVFP GW
Sbjct: 125 NVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGW 184
Query: 189 DKTYCLRYL--DDFNEIHFFGDKTYKGGNDHEIFESERTVGHTVTSPEDTMEKCKALF 244
DK YCLR++ D + I+FFGDKT GGNDHEIF RT+G++VT+PEDT C+ LF
Sbjct: 185 DKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLF 242
|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 229 | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244 | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 243 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 248 | |||
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 100.0 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 100.0 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 100.0 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 100.0 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 100.0 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 100.0 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 100.0 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.98 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 99.97 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.97 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.97 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.96 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.96 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.68 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.59 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 99.21 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 99.08 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 99.04 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 98.99 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.87 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.86 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 98.78 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.73 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 98.51 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 98.49 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 98.45 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.4 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.39 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.31 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 98.07 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 98.03 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 97.91 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.9 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 97.89 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 97.88 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 97.75 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 97.71 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 97.71 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 97.66 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.64 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 97.49 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 97.39 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 97.24 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 97.16 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 97.09 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 96.85 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 96.83 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 96.66 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 96.06 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 95.28 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 95.22 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 94.9 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 94.72 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 94.49 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 94.42 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 94.03 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 93.87 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 93.39 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 93.38 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 93.35 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 93.07 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 92.72 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 92.66 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 92.48 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 91.13 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 89.01 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 86.86 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 86.68 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 86.26 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 85.95 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 84.41 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 81.24 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 81.2 |
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Predicted hydrolases Cof domain: Sugar-phosphate phosphatase BT4131 species: Bacteroides thetaiotaomicron [TaxId: 818]
Probab=100.00 E-value=1e-38 Score=263.93 Aligned_cols=226 Identities=15% Similarity=0.143 Sum_probs=160.7
Q ss_pred eEEEEecCCCCCCCC-CCCCHHHHHHHHHHhhc-CeEEEEcCCChHHHH---HHhcccccCCCceEEecCCcEEEeCCcE
Q 038498 8 LLALFDVDGTLTAPR-KAATPQMLEFMRELRKV-VTVGVVGGSDLSKIS---EQLGKTVIDEYDYVFSENGLVAHKDGKL 82 (248)
Q Consensus 8 kli~~DlDGTLl~~~-~~i~~~~~~al~~l~~~-~~v~iaTGR~~~~~~---~~l~~~~~~~~~~~i~~nGa~i~~~~~~ 82 (248)
|+|||||||||++.+ +.++++++++|++|+++ +.|+++|||++..+. +.... ...+++|++||+.++++++.
T Consensus 2 k~if~DlDGTL~~~~~~~i~~~~~~al~~l~~~gi~v~~~TGR~~~~~~~l~~~~~~---~~~~~~I~~nGa~i~~~~~~ 78 (260)
T d2rbka1 2 KALFFDIDGTLVSFETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIINNLSELQDR---NLIDGYITMNGAYCFVGEEV 78 (260)
T ss_dssp CEEEECSBTTTBCTTTSSCCHHHHHHHHHHHHTTCEEEEECSSCGGGCCSCHHHHHT---TCCCEEEEGGGTEEEETTEE
T ss_pred eEEEEECCCCCcCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHhc---CCCCceEecCCcccccCccc
Confidence 899999999999864 56999999999999999 999999999987543 33322 23578999999999999999
Q ss_pred EEEeecccccchHHHHHHHHHHHHhhccccccccccccceeccccc-eecc--cC-CCCChhhhhhhhh---ccccccch
Q 038498 83 IGTQSLKSFLGGEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGML-NISP--IG-RNCSQEERDEFER---YDKIHNIR 155 (248)
Q Consensus 83 i~~~~~~~~i~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~--~~-~~~~~~~~~~~~~---~~~~~~~~ 155 (248)
++...+ +.+.++++++.++++.....+...++.+....+... .... .. ...+.....+... +.......
T Consensus 79 i~~~~l----~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 154 (260)
T d2rbka1 79 IYKSAI----PQEEVKAMAAFCEKKGVPCIFVEEHNISVCQPNEMVKKIFYDFLHVNVIPTVSFEEASNKEVIQMTPFIT 154 (260)
T ss_dssp EEECCC----CHHHHHHHHHHHHHHTCCEEEECSSCEEEESCCHHHHHHTTTTTCCCCCCBCCHHHHHTSCCSEEEECCC
T ss_pred ccccCC----CHHHHHHHHHHHHHcCCcEEEEecCceeeccchHHHHHHHHHhhccCcCcccCHhHhcCcceEEEeecCC
Confidence 888877 578899999988886433222212222222111110 0000 00 0000000000000 00011122
Q ss_pred HHHHHHHHHHcCCceEEEEecCceEEEEeeCCCCHHHHHHHhhc-----cCCEEEEcCCCCCCCCCHHHHhhCCCceEEc
Q 038498 156 PKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDD-----FNEIHFFGDKTYKGGNDHEIFESERTVGHTV 230 (248)
Q Consensus 156 ~~~~~~l~~~~~~~~~~~~~~~~~~~di~~~~~~K~~al~~l~~-----~~~~~aiGD~~~~~~NDi~M~~~~g~~~~av 230 (248)
+.....+.+.++.+.+..+ ++.++||+|+++||+.|+++|++ ++++++||| +.||++||+.+| +++||
T Consensus 155 ~~~~~~~~~~~~~~~~~~~--~~~~~ei~p~~~sK~~al~~l~~~~~i~~~~~~a~GD----~~ND~~Ml~~a~-~svav 227 (260)
T d2rbka1 155 EEEEKEVLPSIPTCEIGRW--YPAFADVTAKGDTKQKGIDEIIRHFGIKLEETMSFGD----GGNDISMLRHAA-IGVAM 227 (260)
T ss_dssp HHHHHHHGGGSTTCEEECS--STTCCEEESTTCSHHHHHHHHHHHHTCCGGGEEEEEC----SGGGHHHHHHSS-EEEEC
T ss_pred HHHHHHHHHHhccccceee--cCcEEEEEeCCCCHHHHHHHHHHhccccHhheeEecC----CcccHHHHHhCC-eEEEe
Confidence 3444567777887655554 57789999999999999999997 789999999 999999999999 99999
Q ss_pred cCchhhHHHHhhhhccC
Q 038498 231 TSPEDTMEKCKALFLAK 247 (248)
Q Consensus 231 ~Na~~~~k~~A~~v~~~ 247 (248)
+||+|++|+.|++|++.
T Consensus 228 ~na~~~lk~~A~~vt~~ 244 (260)
T d2rbka1 228 GQAKEDVKAAADYVTAP 244 (260)
T ss_dssp TTSCHHHHHHSSEECCC
T ss_pred CCCCHHHHHhCCEEeCC
Confidence 99999999999999864
|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|