Citrus Sinensis ID: 038552


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------66
ANLSRYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAHNSVDTSPMEKQFPMVSYAELSKATSEFASSNMIEGLTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHTRESFLGRRV
ccccccccccEEEccccccEEcccccccccccccEEEccccccEEcccccccccccccccccccccccccccHHHHcccccccEEccccccccccccccccccccccccccccccEEcccHHHHHcccccccEEcccccccccccHHHHHHccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccEEEEcccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHcccccccccccccEEcccccccccccccccccccccccccccccHHHHcccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccHHcccccccccccHHHHccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEEccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHHcccc
cccccccccEEEEcccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHcccccccEEEEEccccccccccccHccccccEEEEcccccccccccHcHccccccEEEEcccccccccccccccHHHHHHcccccEEEEcccccccccccccHccccccEEEEEcEEccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccHcccEEEcccccccccccccccccccEEEEEcccccccccccccEcccccccccccccHccHHHEEEEEEHHcEEEEccHHHHHHcccccEccccccccccccccccHHHHHHHHccccHHcccccccccEEEEEEcccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHEEEEEEcccccccccccEEEEEEEcccccccccccc
anlsrysnLIELRVsknklegqipeEIGSLLNLQTLAIDFnyltgqlpdfvgNLSALKVFYIIGNslggkipttLGLLRNLvdlnvgenrfsgmfprsicnisslewiylpfnrfsgslpldiavnlpnlkalaiggnnffgsipnslsnasnleildltsnqlkgkvsidfsslknlswlnleqnnlgmgtandlDFVTFLTNCSSLKVISLYANqfggelphsIANLSStmtdfriganqisgtippgiRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNnslqgsipsslgnltklvelplsynnlqgnipsslgncQILRMFNASRNkltgalphqlLSITTLTLSLDLsnnllngslplqvgnlknlvkldisgnqfsgvipVTLSACVSLeylnisrnffhgiiplslsslksikefnvssnnlsgLIPEFLKNLSFMEFLDLSynhfegevpkkgvfsnktkislqgnvklcggidelhlpscpskgsikpkitLLRVLIPVVVSCLILSSCLTIIYARRRrfahnsvdtspmekqfpmVSYAELSKATsefassnmiegltLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVlcsmespfermDMRDIVAKLCHTRESFLGRRV
anlsrysnLIELrvsknklegqIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGAnqisgtippGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAhnsvdtspmekqFPMVSYAELSKATSEFASSNMIEGLTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHtresflgrrv
ANLSRYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGElknlqqlslynnslqgsIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQllsittltlsldlsnnllngslplQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGiiplslsslksikEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAHNSVDTSPMEKQFPMVSYAELSKATSEFASSNMIEGLTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHTRESFLGRRV
*********IELR*****LEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAH***********************************LTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHTR********
ANLSRYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDE*******************RVLIPVVVSCLILSSCLTIIY********************PMVSYAELSKATSEFASSNMIEGLTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHTRESFLGRRV
ANLSRYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAHNSVDTSPMEKQFPMVSYAELSKATSEFASSNMIEGLTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHTRESFLGRRV
****RYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAHNSVDTSPMEKQFPMVSYAELSKATSEFASSNMIEGLTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHT*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ANLSRYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAHNSVDTSPMEKQFPMVSYAELSKATSEFASSNMIEGLTLHEYAKMALQEKVMEIIDPSLLMDVIENNSKIREDRRAKLEECLNAIIRTGVLCSMESPFERMDMRDIVAKLCHTRESFLGRRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query659 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.877 0.572 0.404 1e-109
C0LGT6 1031 LRR receptor-like serine/ no no 0.863 0.551 0.410 1e-104
Q9SD62 1025 Putative receptor-like pr no no 0.942 0.605 0.396 2e-96
Q9ZUI0 980 Putative leucine-rich rep no no 0.889 0.597 0.335 1e-74
Q9FL28 1173 LRR receptor-like serine/ no no 0.872 0.490 0.322 3e-71
Q8VZG8 1045 Probable LRR receptor-lik no no 0.880 0.555 0.286 8e-69
Q9LHP4 1141 Receptor-like protein kin no no 0.704 0.406 0.377 2e-68
O49318 1124 Probable leucine-rich rep no no 0.763 0.447 0.327 1e-66
Q9LP24 1120 Probable leucine-rich rep no no 0.955 0.562 0.284 4e-65
C0LGQ5 1249 LRR receptor-like serine/ no no 0.711 0.375 0.365 1e-63
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  397 bits (1020), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 239/591 (40%), Positives = 360/591 (60%), Gaps = 13/591 (2%)

Query: 7   SNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNS 66
           S L+ LR+  N+L G +P E+GSL NL  L +  N + G+LP  +GNL+ L+   +  N+
Sbjct: 138 SRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNN 197

Query: 67  LGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVN 126
           L G+IP+ +  L  +  L +  N FSG+FP ++ N+SSL+ + + +N FSG L  D+ + 
Sbjct: 198 LEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGIL 257

Query: 127 LPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQN 186
           LPNL +  +GGN F GSIP +LSN S LE L +  N L G +   F ++ NL  L L  N
Sbjct: 258 LPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIPT-FGNVPNLKLLFLHTN 316

Query: 187 NLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGT 246
           +LG  ++ DL+F+T LTNC+ L+ + +  N+ GG+LP SIANLS+ +    +G   ISG+
Sbjct: 317 SLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGS 376

Query: 247 IPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLV 306
           IP  I NL+NL  L ++ N L G +P ++G+L NL+ LSL++N L G IP+ +GN+T L 
Sbjct: 377 IPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLE 436

Query: 307 ELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNG 366
            L LS N  +G +P+SLGNC  L       NKL G +P +++ I  L L LD+S N L G
Sbjct: 437 TLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQL-LRLDMSGNSLIG 495

Query: 367 SLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSI 426
           SLP  +G L+NL  L +  N+ SG +P TL  C+++E L +  N F+G IP  L  L  +
Sbjct: 496 SLPQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLFYGDIP-DLKGLVGV 554

Query: 427 KEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCG 486
           KE ++S+N+LSG IPE+  + S +E+L+LS+N+ EG+VP KG+F N T +S+ GN  LCG
Sbjct: 555 KEVDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFENATTVSIVGNNDLCG 614

Query: 487 GIDELHL-------PSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAHN 539
           GI    L       PS   K S + K  ++ V + + +  L+  + +T+I+ R+R+    
Sbjct: 615 GIMGFQLKPCLSQAPSVVKKHSSRLKKVVIGVSVGITLLLLLFMASVTLIWLRKRKKNKE 674

Query: 540 SVDTSP--MEKQFPMVSYAELSKATSEFASSNMIEGLTLHE-YAKMALQEK 587
           + + +P  +E     +SY +L  AT+ F+SSNM+   +    Y  + L EK
Sbjct: 675 TNNPTPSTLEVLHEKISYGDLRNATNGFSSSNMVGSGSFGTVYKALLLTEK 725





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query659
357484501 1006 Kinase-like protein [Medicago truncatula 0.861 0.564 0.472 1e-131
359482058 1040 PREDICTED: probable LRR receptor-like se 0.861 0.546 0.473 1e-129
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.861 0.298 0.472 1e-128
357484467 1030 Kinase-like protein [Medicago truncatula 0.863 0.552 0.453 1e-127
255553269 2793 receptor-kinase, putative [Ricinus commu 0.861 0.203 0.457 1e-127
357484195 1032 Receptor kinase-like protein [Medicago t 0.889 0.567 0.458 1e-126
357497603 1027 CCP [Medicago truncatula] gi|355494105|g 0.861 0.553 0.464 1e-126
224119022 1021 predicted protein [Populus trichocarpa] 0.928 0.599 0.438 1e-125
255577438 1028 receptor-kinase, putative [Ricinus commu 0.861 0.552 0.449 1e-125
224115346 1017 predicted protein [Populus trichocarpa] 0.922 0.597 0.447 1e-124
>gi|357484501|ref|XP_003612538.1| Kinase-like protein [Medicago truncatula] gi|355513873|gb|AES95496.1| Kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  475 bits (1222), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 271/574 (47%), Positives = 372/574 (64%), Gaps = 6/574 (1%)

Query: 1   ANLSRYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVF 60
           +NL+  SNL  L V  N + G+IP EIGSL  LQ + +  N LTG  P F+GNLS+L   
Sbjct: 126 SNLTYCSNLKGLNVGGNNVIGKIPIEIGSLKKLQLINVWGNNLTGGFPSFIGNLSSLIGI 185

Query: 61  YIIGNSLGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLP 120
            +  N+L G+IP  +  L+N+  L+VGEN  SGMFP  + NISSL  + L  N+F GSLP
Sbjct: 186 AVTYNNLKGEIPQEICNLKNIRRLHVGENNLSGMFPSCLYNISSLTQLSLTENKFIGSLP 245

Query: 121 LDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSW 180
            ++   LPNL    IG N FFGS+P S+ NAS+L++LDL  N L G+V      L++L W
Sbjct: 246 SNLFNTLPNLNMFQIGKNQFFGSMPISIVNASSLQLLDLAQNYLVGQVP-SLEKLQDLYW 304

Query: 181 LNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGA 240
           LNLE N  G  +  DL+F+ +LTNCS L+V+S+  N+FGG LP+SI +LS+ +T+  +G 
Sbjct: 305 LNLEDNYFGNNSTIDLEFLKYLTNCSKLEVVSICNNKFGGSLPNSIGSLSTQLTELCLGG 364

Query: 241 NQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLG 300
           N ISG IP  I NLV LI L ++ N   G IP + G+ + +Q L+L  N L G IP  +G
Sbjct: 365 NLISGKIPVEIGNLVELILLAIDFNHFEGIIPTSFGKFQKMQYLALSGNKLSGYIPPFIG 424

Query: 301 NLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLS 360
           NL++L +L L  N  QGNIP S+ NCQ L+  + S NKL+G +P ++  I +L+  L+LS
Sbjct: 425 NLSQLFKLDLYRNMFQGNIPPSIENCQKLQYLDLSHNKLSGTIPSEIFHIFSLSNLLNLS 484

Query: 361 NNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSL 420
           +N L+GSLP +VG LKN+  LD+S N  SG IP T+  C +LEYL++  N F+G IP SL
Sbjct: 485 HNFLSGSLPREVGLLKNIDWLDVSENHLSGDIPTTIGDCTALEYLHLQGNSFNGTIPSSL 544

Query: 421 SSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQG 480
           +SL+ ++  ++S N LSG IP+ ++N+S +E+L++S+N  EGEVPK GVF N TK+ L G
Sbjct: 545 ASLEGLQHLDLSRNRLSGSIPDVMQNISVLEYLNVSFNMLEGEVPKNGVFGNVTKVELIG 604

Query: 481 NVKLCGGIDELHLPSCPSKG---SIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFA 537
           N KLCGGI  LHLP CP KG   +   K  L+ V++ VV   LILS  +TI + R+R   
Sbjct: 605 NNKLCGGILLLHLPPCPIKGRKDTKHHKFMLVAVIVSVVFFLLILSFIITIYWVRKRN-N 663

Query: 538 HNSVDTSPMEKQFPMVSYAELSKATSEFASSNMI 571
             S+D SP   Q   VSY +L   T+ F+S N+I
Sbjct: 664 KRSID-SPTIDQLATVSYQDLHHGTNGFSSRNLI 696




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482058|ref|XP_002274540.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357484467|ref|XP_003612521.1| Kinase-like protein [Medicago truncatula] gi|355513856|gb|AES95479.1| Kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255553269|ref|XP_002517677.1| receptor-kinase, putative [Ricinus communis] gi|223543309|gb|EEF44841.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357484195|ref|XP_003612385.1| Receptor kinase-like protein [Medicago truncatula] gi|355513720|gb|AES95343.1| Receptor kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357497603|ref|XP_003619090.1| CCP [Medicago truncatula] gi|355494105|gb|AES75308.1| CCP [Medicago truncatula] Back     alignment and taxonomy information
>gi|224119022|ref|XP_002331306.1| predicted protein [Populus trichocarpa] gi|222873889|gb|EEF11020.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255577438|ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis] gi|223530931|gb|EEF32790.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224115346|ref|XP_002317009.1| predicted protein [Populus trichocarpa] gi|222860074|gb|EEE97621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query659
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.877 0.572 0.363 1.5e-102
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.954 0.613 0.374 2.8e-98
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.863 0.562 0.353 1.8e-97
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.883 0.576 0.359 3.7e-97
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.930 0.598 0.340 1.3e-96
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.861 0.550 0.375 2e-96
UNIPROTKB|O24435813 O24435 "Receptor kinase-like p 0.861 0.698 0.350 2e-88
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.834 0.489 0.299 1.1e-63
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.874 0.491 0.302 1.7e-62
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.742 0.498 0.326 1.9e-62
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 933 (333.5 bits), Expect = 1.5e-102, Sum P(2) = 1.5e-102
 Identities = 215/591 (36%), Positives = 328/591 (55%)

Query:     7 SNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNS 66
             S L+ LR+  N+L G +P E+GSL NL  L +  N + G+LP  +GNL+ L+   +  N+
Sbjct:   138 SRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNN 197

Query:    67 LGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVN 126
             L G+IP+ +  L  +  L +  N FSG+FP ++ N+SSL+ + + +N FSG L  D+ + 
Sbjct:   198 LEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGIL 257

Query:   127 LPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQN 186
             LPNL +  +GGN F GSIP +LSN S LE L +  N L G +   F ++ NL  L L  N
Sbjct:   258 LPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIPT-FGNVPNLKLLFLHTN 316

Query:   187 NLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGT 246
             +LG  ++ DL+F+T LTNC+ L+ + +  N+ GG+LP SIANLS+ +    +G   ISG+
Sbjct:   317 SLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGS 376

Query:   247 IPPGIRNLVNLIALTMEINKLHGTIPDTIGEXXXXXXXXXXXXXXXXXIPSSLGNLTKLV 306
             IP  I NL+NL  L ++ N L G +P ++G+                 IP+ +GN+T L 
Sbjct:   377 IPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLE 436

Query:   307 ELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQXXXXXXXXXXXXXXXXXXXX 366
              L LS N  +G +P+SLGNC  L       NKL G +P +                    
Sbjct:   437 TLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGS 496

Query:   367 XXXXQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGXXXXXXXXXXXX 426
                  +G L+NL  L +  N+ SG +P TL  C+++E L +  N F+G            
Sbjct:   497 LPQ-DIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLFYGDIPDLKGLVGVK 555

Query:   427 XEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCG 486
              E ++S+N+LSG IPE+  + S +E+L+LS+N+ EG+VP KG+F N T +S+ GN  LCG
Sbjct:   556 -EVDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFENATTVSIVGNNDLCG 614

Query:   487 GIDELHLPSC----PS---KGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRRFAHN 539
             GI    L  C    PS   K S + K  ++ V + + +  L+  + +T+I+ R+R+    
Sbjct:   615 GIMGFQLKPCLSQAPSVVKKHSSRLKKVVIGVSVGITLLLLLFMASVTLIWLRKRKKNKE 674

Query:   540 SVDTSP--MEKQFPMVSYAELSKATSEFASSNMI-EGLTLHEYAKMALQEK 587
             + + +P  +E     +SY +L  AT+ F+SSNM+  G     Y  + L EK
Sbjct:   675 TNNPTPSTLEVLHEKISYGDLRNATNGFSSSNMVGSGSFGTVYKALLLTEK 725


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01680029
hypothetical protein (1021 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query659
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-80
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-62
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-59
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-49
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  272 bits (698), Expect = 6e-80
 Identities = 174/529 (32%), Positives = 279/529 (52%), Gaps = 12/529 (2%)

Query: 7   SNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNS 66
            NL  L +S N L G+IP +IGS  +L+ L +  N L G++P+ + NL++L+   +  N 
Sbjct: 140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQ 199

Query: 67  LGGKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVN 126
           L G+IP  LG +++L  + +G N  SG  P  I  ++SL  + L +N  +G +P  +  N
Sbjct: 200 LVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG-N 258

Query: 127 LPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQN 186
           L NL+ L +  N   G IP S+ +   L  LDL+ N L G++      L+NL  L+L  N
Sbjct: 259 LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN 318

Query: 187 NLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISGT 246
           N   G          LT+   L+V+ L++N+F GE+P ++    + +T   +  N ++G 
Sbjct: 319 NF-TGK-----IPVALTSLPRLQVLQLWSNKFSGEIPKNLGK-HNNLTVLDLSTNNLTGE 371

Query: 247 IPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLV 306
           IP G+ +  NL  L +  N L G IP ++G  ++L+++ L +NS  G +PS    L  + 
Sbjct: 372 IPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVY 431

Query: 307 ELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNG 366
            L +S NNLQG I S   +   L+M + +RNK  G LP      +    +LDLS N  +G
Sbjct: 432 FLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPD--SFGSKRLENLDLSRNQFSG 489

Query: 367 SLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSI 426
           ++P ++G+L  L++L +S N+ SG IP  LS+C  L  L++S N   G IP S S +  +
Sbjct: 490 AVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVL 549

Query: 427 KEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCG 486
            + ++S N LSG IP+ L N+  +  +++S+NH  G +P  G F      ++ GN+ LCG
Sbjct: 550 SQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609

Query: 487 GIDELHLPSCPSKGSIKPKITLLRVLIPVVVSCLILSSCLTIIYARRRR 535
           G     LP C  K   K       +   +    ++       ++ R R 
Sbjct: 610 GDTTSGLPPC--KRVRKTPSWWFYITCTLGAFLVLALVAFGFVFIRGRN 656


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 659
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
PLN03150623 hypothetical protein; Provisional 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
PLN03150623 hypothetical protein; Provisional 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.04
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.8
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.72
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.6
KOG1187361 consensus Serine/threonine protein kinase [Signal 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
PRK15386426 type III secretion protein GogB; Provisional 97.89
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
KOG4341483 consensus F-box protein containing LRR [General fu 97.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
KOG4341483 consensus F-box protein containing LRR [General fu 97.69
PRK15386426 type III secretion protein GogB; Provisional 97.67
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.57
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.51
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.23
KOG4308478 consensus LRR-containing protein [Function unknown 96.11
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.97
KOG1187 361 consensus Serine/threonine protein kinase [Signal 95.2
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.13
KOG4308478 consensus LRR-containing protein [Function unknown 94.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.64
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 91.87
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.71
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 90.24
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 89.65
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.5
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 89.47
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 88.7
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 88.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.18
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 88.01
smart0037026 LRR Leucine-rich repeats, outliers. 87.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.74
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.61
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 87.26
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 87.19
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.96
smart0037026 LRR Leucine-rich repeats, outliers. 86.66
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.66
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 86.6
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 86.51
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 86.5
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 85.96
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 85.87
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 85.86
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 85.73
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 85.62
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 85.45
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 85.42
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 85.24
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 85.05
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 84.82
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 84.7
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 84.6
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 84.57
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 84.56
PHA02988283 hypothetical protein; Provisional 84.42
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 84.37
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 83.87
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 83.82
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 83.7
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 83.55
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 83.52
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 83.34
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 83.31
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 83.23
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 83.22
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 83.05
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 82.99
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 82.76
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 82.51
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 82.46
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 82.29
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 81.92
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 81.85
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 81.43
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 81.35
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 81.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.05
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 80.97
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 80.88
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 80.38
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 80.09
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.8e-66  Score=593.53  Aligned_cols=483  Identities=35%  Similarity=0.593  Sum_probs=346.1

Q ss_pred             CCCCCEEEccCCcccccCchhhcCCCCCcEEeccccCCCccccccccCCCCCcEEEccCCccCcccccccCCCCCCCEEE
Q 038552            6 YSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGKIPTTLGLLRNLVDLN   85 (659)
Q Consensus         6 ~~~L~~L~ls~n~~~~~~~~~~~~~~~L~~L~ls~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~   85 (659)
                      +++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..++++++|++|+
T Consensus       139 l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  218 (968)
T PLN00113        139 IPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY  218 (968)
T ss_pred             cCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEE
Confidence            34444444444444444555555555555555555555555555555555555555555555555555555555555555


Q ss_pred             eecCcCCccCcccccCCCCCCEEeccCccccccChHHHhcCCCCCcEEEccCCcCCcccChhccCCCCCCEEEccCCCCc
Q 038552           86 VGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLK  165 (659)
Q Consensus        86 l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~  165 (659)
                      +++|.+++.+|..++++++|++|++++|.+++.+|..+. .+++|+.|++++|.+++.+|..+.++++|++|++++|.+.
T Consensus       219 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~  297 (968)
T PLN00113        219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG-NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS  297 (968)
T ss_pred             CcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHh-CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeec
Confidence            555555555555555555555555555555545555444 4555555555555555555555555555555555555555


Q ss_pred             cccccccCCCCCCCEEECCCCCCCCCCCCCccccccccCCCCCcEEEccCCccccccChhHHhccccCCEEEcccCcccc
Q 038552          166 GKVSIDFSSLKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIGANQISG  245 (659)
Q Consensus       166 ~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  245 (659)
                      +.+|..+..+++|+.|++++|.+.+      ..+..+..+++|+.|++++|.+.+.+|..+..+. +|+.|++++|.+++
T Consensus       298 ~~~p~~~~~l~~L~~L~l~~n~~~~------~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~-~L~~L~Ls~n~l~~  370 (968)
T PLN00113        298 GEIPELVIQLQNLEILHLFSNNFTG------KIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHN-NLTVLDLSTNNLTG  370 (968)
T ss_pred             cCCChhHcCCCCCcEEECCCCccCC------cCChhHhcCCCCCEEECcCCCCcCcCChHHhCCC-CCcEEECCCCeeEe
Confidence            5555555555555555555555543      3344555666677777777766666666666654 67777777777776


Q ss_pred             cCCcccccCCCcCeeecccccCCCCCCccccCCCCCcEEEccCCCCCCCCCccccCCCCCcEEEccCCccccccCccCcC
Q 038552          246 TIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLSYNNLQGNIPSSLGN  325 (659)
Q Consensus       246 ~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~  325 (659)
                      .+|.++..+++|+.|++++|.+.+.+|..++.+++|+.|++++|++.+.+|..+..++.|+.|++++|.+.+.+|..+..
T Consensus       371 ~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~  450 (968)
T PLN00113        371 EIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWD  450 (968)
T ss_pred             eCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhcc
Confidence            66766666777777777777777777777777777777777777777777777777777888888887777777777777


Q ss_pred             CCCCCEEeCCCcccccccchhhhhcccccceeccccccccCCCccccccCCCCceeecCCCcccccCCccccCCCCCCeE
Q 038552          326 CQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYL  405 (659)
Q Consensus       326 ~~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L  405 (659)
                      +++|+.|++++|++.+.+|..+ ..+.++ .|++++|++.+..|..+..+++|++|+|++|++.+.+|..+.++++|++|
T Consensus       451 l~~L~~L~L~~n~~~~~~p~~~-~~~~L~-~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L  528 (968)
T PLN00113        451 MPSLQMLSLARNKFFGGLPDSF-GSKRLE-NLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSL  528 (968)
T ss_pred             CCCCcEEECcCceeeeecCccc-ccccce-EEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEE
Confidence            7888888888888877777654 346676 89999999999999999999999999999999999999999999999999


Q ss_pred             ECCCCCCCCCCcccccCCCCCCEEECCCCcccccchhhhcCCCCCCeeeCcCCcCcccCCCCCccCCcccccccCCCCCc
Q 038552          406 NISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLC  485 (659)
Q Consensus       406 ~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~l~l~~n~l~~~~p~~~~~~~~~~~~~~~n~~lc  485 (659)
                      +|++|.+++.+|..+..+++|+.|++++|++++.+|..+..+++|+.+++++|++.+.+|..+.+..+...++.||+.+|
T Consensus       529 ~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc  608 (968)
T PLN00113        529 DLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLC  608 (968)
T ss_pred             ECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999989899999999999


Q ss_pred             ccCCCCCCCCCCC
Q 038552          486 GGIDELHLPSCPS  498 (659)
Q Consensus       486 ~~~~~~~~~~c~~  498 (659)
                      ++.+....++|..
T Consensus       609 ~~~~~~~~~~c~~  621 (968)
T PLN00113        609 GGDTTSGLPPCKR  621 (968)
T ss_pred             CCccccCCCCCcc
Confidence            8765555667753



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query659
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-35
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-30
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-35
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-30
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-12
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 147 bits (371), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 126/409 (30%), Positives = 193/409 (47%), Gaps = 39/409 (9%) Query: 9 LIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLG 68 L L +S NK+ G + ++ +NL+ L + N + +P F+G+ SAL+ I GN L Sbjct: 177 LKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLS 233 Query: 69 GKIPTTLGLLRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLP 128 G + L LN+ N+F G P + SL+++ L N+F+G +P ++ Sbjct: 234 GDFSRAISTCTELKLLNISSNQFVGPIPP--LPLKSLQYLSLAENKFTGEIPDFLSGACD 291 Query: 129 NLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSID-FSSLKNLSWLNLEQNN 187 L L + GN+F+G++P + S LE L L+SN G++ +D ++ L L+L N Sbjct: 292 TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE 351 Query: 188 LGMGTANDLDFVTFLTNCS-SLKVISLYANQFGGE-LPHSIANLSSTMTDFRIGANQISG 245 + LTN S SL + L +N F G LP+ N +T+ + + N +G Sbjct: 352 FSG------ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 405 Query: 246 TIPPGIRNLVNLIALTMEINKLHGTIPDTIGEXXXXXXXXXXXXXXXXXIPSSLGNLTKL 305 IPP + N L++L + N L GTIP ++G IP L + L Sbjct: 406 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 465 Query: 306 VELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQXXXXXXXXXXXXXXXXXXX 365 L L +N+L G IPS L NC L + S N+LTG +P Sbjct: 466 ETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW------------------- 506 Query: 366 XXXXXQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHG 414 +G L+NL L +S N FSG IP L C SL +L+++ N F+G Sbjct: 507 ------IGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNG 549
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query659
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-140
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-118
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-117
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-107
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-76
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-64
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-59
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-71
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-43
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-69
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-64
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-51
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-48
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-58
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-43
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-36
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-41
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-25
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-46
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-42
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-34
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-32
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-29
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-27
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  425 bits (1096), Expect = e-140
 Identities = 144/508 (28%), Positives = 235/508 (46%), Gaps = 22/508 (4%)

Query: 4   SRYSNLIELRVSKNKLEGQIPEEI-GSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYI 62
               +L  L +++NK  G+IP+ + G+   L  L +  N+  G +P F G+ S L+   +
Sbjct: 266 LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLAL 325

Query: 63  IGNSLGGKIPT-TLGLLRNLVDLNVGENRFSGMFPRSICNIS-SLEWIYLPFNRFSGSLP 120
             N+  G++P  TL  +R L  L++  N FSG  P S+ N+S SL  + L  N FSG + 
Sbjct: 326 SSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPIL 385

Query: 121 LDIAVN-LPNLKALAIGGNNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLS 179
            ++  N    L+ L +  N F G IP +LSN S L  L L+ N L G +     SL  L 
Sbjct: 386 PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR 445

Query: 180 WLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQFGGELPHSIANLSSTMTDFRIG 239
            L L  N L  G          L    +L+ + L  N   GE+P  ++N ++ +    + 
Sbjct: 446 DLKLWLNMLE-GE-----IPQELMYVKTLETLILDFNDLTGEIPSGLSNCTN-LNWISLS 498

Query: 240 ANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSL 299
            N+++G IP  I  L NL  L +  N   G IP  +G+ ++L  L L  N   G+IP+++
Sbjct: 499 NNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 558

Query: 300 GNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRN--KLTGALPHQLLSITTLTLSL 357
              +      ++ N + G     + N  + +  + + N  +  G    QL  ++T     
Sbjct: 559 FKQSGK----IAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRN-PC 613

Query: 358 DLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIP 417
           ++++ +  G       N  +++ LD+S N  SG IP  + +   L  LN+  N   G IP
Sbjct: 614 NITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP 673

Query: 418 LSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKIS 477
             +  L+ +   ++SSN L G IP+ +  L+ +  +DLS N+  G +P+ G F       
Sbjct: 674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAK 733

Query: 478 LQGNVKLCGGIDELHLPSCPSKGSIKPK 505
              N  LCG      LP C    +    
Sbjct: 734 FLNNPGLCG----YPLPRCDPSNADGYA 757


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query659
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.43
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.23
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.14
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.31
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 95.65
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 95.58
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 95.44
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 94.03
4aoj_A329 High affinity nerve growth factor receptor; transf 93.78
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 92.43
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 91.52
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 91.18
3soc_A322 Activin receptor type-2A; structural genomics cons 90.9
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 90.56
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 90.42
4ase_A353 Vascular endothelial growth factor receptor 2; tra 89.48
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 89.35
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 89.23
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 89.21
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 88.47
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 88.42
3q4u_A301 Activin receptor type-1; structural genomics conso 88.4
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 87.34
3pls_A298 Macrophage-stimulating protein receptor; protein k 86.83
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 86.77
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 86.75
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 86.71
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 86.57
3poz_A327 Epidermal growth factor receptor; kinase domain, a 86.49
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 86.04
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 85.95
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 85.92
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 84.6
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 84.42
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 84.23
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 83.94
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 83.68
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 83.34
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 83.34
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 83.01
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 82.98
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 82.64
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 82.53
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 82.51
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 82.43
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 82.35
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 82.32
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 82.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 81.37
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 81.33
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 81.3
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 80.94
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 80.82
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 80.74
2xir_A316 Vascular endothelial growth factor receptor 2; ang 80.39
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 80.36
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-62  Score=546.70  Aligned_cols=485  Identities=33%  Similarity=0.512  Sum_probs=319.4

Q ss_pred             CCCCCCCEEEccCCcccccCchhhcCCCCCcEEeccccCCCccccccccCCCCCcEEEccCCccCcc-------------
Q 038552            4 SRYSNLIELRVSKNKLEGQIPEEIGSLLNLQTLAIDFNYLTGQLPDFVGNLSALKVFYIIGNSLGGK-------------   70 (659)
Q Consensus         4 ~~~~~L~~L~ls~n~~~~~~~~~~~~~~~L~~L~ls~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~-------------   70 (659)
                      .++++|++|++++|.+++.+|. +.++++|++|++++|.+++.+|..+.++++|++|++++|.+.+.             
T Consensus       197 ~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~  275 (768)
T 3rgz_A          197 SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLS  275 (768)
T ss_dssp             TTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEE
T ss_pred             ccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEE
Confidence            4566666666666666655554 66666666666666666666666666666666666666655444             


Q ss_pred             ---------cccccCCC-CCCCEEEeecCcCCccCcccccCCCCCCEEeccCccccccChHHHhcCCCCCcEEEccCCcC
Q 038552           71 ---------IPTTLGLL-RNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGGNNF  140 (659)
Q Consensus        71 ---------~~~~~~~l-~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~~  140 (659)
                               +|..+... ++|++|++++|.+++.+|..++++++|++|++++|.+++.+|......+++|++|++++|.+
T Consensus       276 L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l  355 (768)
T 3rgz_A          276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF  355 (768)
T ss_dssp             CCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEE
T ss_pred             CcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCcc
Confidence                     44444332 45555555555554445555555555555555555554445444223455555555555555


Q ss_pred             CcccChhccCCC-CCCEEEccCCCCccccccccCC--CCCCCEEECCCCCCCCCCCCCccccccccCCCCCcEEEccCCc
Q 038552          141 FGSIPNSLSNAS-NLEILDLTSNQLKGKVSIDFSS--LKNLSWLNLEQNNLGMGTANDLDFVTFLTNCSSLKVISLYANQ  217 (659)
Q Consensus       141 ~~~~~~~l~~l~-~L~~L~l~~n~l~~~~~~~l~~--l~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~~~L~~L~l~~n~  217 (659)
                      ++.+|..+.+++ +|++|++++|.+++.++..+..  +++|++|++++|.+++      .++..+..+++|++|++++|.
T Consensus       356 ~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~------~~p~~l~~l~~L~~L~Ls~N~  429 (768)
T 3rgz_A          356 SGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG------KIPPTLSNCSELVSLHLSFNY  429 (768)
T ss_dssp             EECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEE------ECCGGGGGCTTCCEEECCSSE
T ss_pred             CccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccc------ccCHHHhcCCCCCEEECcCCc
Confidence            444455444444 4555555555555444444443  4455555555555443      334455556666666666666


Q ss_pred             cccccChhHHhccccCCEEEcccCcccccCCcccccCCCcCeeecccccCCCCCCccccCCCCCcEEEccCCCCCCCCCc
Q 038552          218 FGGELPHSIANLSSTMTDFRIGANQISGTIPPGIRNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPS  297 (659)
Q Consensus       218 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~  297 (659)
                      +.+.+|..+..+. +|+.|++++|.+++.+|..+..+++|+.|++++|.+++.+|..+..+++|++|++++|++.+.+|.
T Consensus       430 l~~~~p~~l~~l~-~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~  508 (768)
T 3rgz_A          430 LSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK  508 (768)
T ss_dssp             EESCCCGGGGGCT-TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCG
T ss_pred             ccCcccHHHhcCC-CCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCCh
Confidence            6666666655554 566666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             cccCCCCCcEEEccCCccccccCccCcCCCCCCEEeCCCcccccccchhhhhcccccc----------------------
Q 038552          298 SLGNLTKLVELPLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTL----------------------  355 (659)
Q Consensus       298 ~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~l~~----------------------  355 (659)
                      .++.+++|++|++++|.+.+.+|..+..+++|+.|++++|+++|.+|..++....+..                      
T Consensus       509 ~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  588 (768)
T 3rgz_A          509 WIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECH  588 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCC
T ss_pred             HHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccc
Confidence            6666666666666666666666666666666666666666666666655544322210                      


Q ss_pred             -----------------------eeccccccccCCCccccccCCCCceeecCCCcccccCCccccCCCCCCeEECCCCCC
Q 038552          356 -----------------------SLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFF  412 (659)
Q Consensus       356 -----------------------~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~l~~n~l  412 (659)
                                             .++++.|.+.|.+|..+..+++|++|+|++|+++|.+|..+++++.|++|+|++|.+
T Consensus       589 ~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l  668 (768)
T 3rgz_A          589 GAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDI  668 (768)
T ss_dssp             SSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCC
T ss_pred             ccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCcc
Confidence                                   122333445555566667788999999999999999999999999999999999999


Q ss_pred             CCCCcccccCCCCCCEEECCCCcccccchhhhcCCCCCCeeeCcCCcCcccCCCCCccCCcccccccCCCCCcccCCCCC
Q 038552          413 HGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKGVFSNKTKISLQGNVKLCGGIDELH  492 (659)
Q Consensus       413 ~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~l~l~~n~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~  492 (659)
                      +|.+|..++++++|+.|||++|+++|.+|..+..+++|+.||+++|+++|.+|..+.+.++...++.|||++||.+    
T Consensus       669 ~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~----  744 (768)
T 3rgz_A          669 SGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYP----  744 (768)
T ss_dssp             CSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTT----
T ss_pred             CCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCC----
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999864    


Q ss_pred             CCCCCCCC
Q 038552          493 LPSCPSKG  500 (659)
Q Consensus       493 ~~~c~~~~  500 (659)
                      .++|....
T Consensus       745 l~~C~~~~  752 (768)
T 3rgz_A          745 LPRCDPSN  752 (768)
T ss_dssp             SCCCCSCC
T ss_pred             CcCCCCCc
Confidence            23676443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 659
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-23
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-10
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 8e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score =  100 bits (249), Expect = 2e-23
 Identities = 76/387 (19%), Positives = 137/387 (35%), Gaps = 30/387 (7%)

Query: 78  LRNLVDLNVGENRFSGMFPRSICNISSLEWIYLPFNRFSGSLPLDIAVNLPNLKALAIGG 137
           L   +   +G+   +    ++  ++  +  +            +D    L NL  +    
Sbjct: 21  LAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIKS---IDGVEYLNNLTQINFSN 75

Query: 138 NNFFGSIPNSLSNASNLEILDLTSNQLKGKVSIDFSSLKNLSWLNLEQNNLGMGTANDLD 197
           N      P  L N + L  + + +NQ+     +   +      L   Q        N  +
Sbjct: 76  NQLTDITP--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTN 133

Query: 198 FVTFLTNCSSLKVISLYANQFGGELPHSIAN------LSSTMTDFRIGANQISGTIPPGI 251
                 + +++  IS  +     +             L++  T  R+  +    +    +
Sbjct: 134 LNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVL 193

Query: 252 RNLVNLIALTMEINKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVELPLS 311
             L NL +L    N++    P  I    NL +LSL  N L+     +L +LT L +L L+
Sbjct: 194 AKLTNLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLA 249

Query: 312 YNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQ 371
            N +    P  L     L       N+++   P   L+  T         N         
Sbjct: 250 NNQISNLAP--LSGLTKLTELKLGANQISNISPLAGLTALTNL-----ELNENQLEDISP 302

Query: 372 VGNLKNLVKLDISGNQFSGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNV 431
           + NLKNL  L +  N  S + P  +S+   L+ L  + N        SL++L +I   + 
Sbjct: 303 ISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSA 358

Query: 432 SSNNLSGLIPEFLKNLSFMEFLDLSYN 458
             N +S L P  L NL+ +  L L+  
Sbjct: 359 GHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query659
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.78
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.83
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 94.99
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 94.91
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 94.91
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 93.53
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 93.46
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 92.97
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 92.14
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 91.98
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 91.88
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 91.85
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 91.59
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 91.35
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 91.08
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 91.03
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 89.27
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 89.2
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 88.73
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 88.37
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 87.93
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 87.52
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 86.77
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 85.26
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 85.11
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=3.5e-31  Score=262.11  Aligned_cols=255  Identities=27%  Similarity=0.446  Sum_probs=224.2

Q ss_pred             cCCEEEcccCcccc--cCCcccccCCCcCeeeccc-ccCCCCCCccccCCCCCcEEEccCCCCCCCCCccccCCCCCcEE
Q 038552          232 TMTDFRIGANQISG--TIPPGIRNLVNLIALTMEI-NKLHGTIPDTIGELKNLQQLSLYNNSLQGSIPSSLGNLTKLVEL  308 (659)
Q Consensus       232 ~L~~L~l~~~~~~~--~~~~~l~~l~~L~~L~l~~-n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L  308 (659)
                      .++.|+++++.+++  .+|..++++++|++|+|++ |.++|.+|..++.+++|++|++++|++.+..+..+..++.|+.+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            35566666666655  4778888888999999986 78888888888899999999999999888888888888999999


Q ss_pred             EccCCccccccCccCcCCCCCCEEeCCCcccccccchhhhhcccccceeccccccccCCCccccccCCCCceeecCCCcc
Q 038552          309 PLSYNNLQGNIPSSLGNCQILRMFNASRNKLTGALPHQLLSITTLTLSLDLSNNLLNGSLPLQVGNLKNLVKLDISGNQF  388 (659)
Q Consensus       309 ~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l  388 (659)
                      ++++|.+.+.+|..+..++.++.+++++|.+.+.+|..+..+..+...+++++|++.+..|..+..+..+ .++++++..
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~  209 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNML  209 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccc
Confidence            9999988888888899999999999999999988998888888875588999999998888888877655 699999999


Q ss_pred             cccCCccccCCCCCCeEECCCCCCCCCCcccccCCCCCCEEECCCCcccccchhhhcCCCCCCeeeCcCCcCcccCCCCC
Q 038552          389 SGVIPVTLSACVSLEYLNISRNFFHGIIPLSLSSLKSIKEFNVSSNNLSGLIPEFLKNLSFMEFLDLSYNHFEGEVPKKG  468 (659)
Q Consensus       389 ~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~l~l~~n~l~~~~p~~~  468 (659)
                      .+.+|..+..+++++.+++++|.+.+.+| .+..+++|+.|++++|+++|.+|+.+..+++|++|++++|+++|.+|..+
T Consensus       210 ~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~  288 (313)
T d1ogqa_         210 EGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGG  288 (313)
T ss_dssp             EECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCST
T ss_pred             ccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcc
Confidence            99999999999999999999999987765 68889999999999999999999999999999999999999999999888


Q ss_pred             ccCCcccccccCCCCCcccC
Q 038552          469 VFSNKTKISLQGNVKLCGGI  488 (659)
Q Consensus       469 ~~~~~~~~~~~~n~~lc~~~  488 (659)
                      .+.+++.+++.||+.+||.+
T Consensus       289 ~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         289 NLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             TGGGSCGGGTCSSSEEESTT
T ss_pred             cCCCCCHHHhCCCccccCCC
Confidence            88899999999999999853



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure