Citrus Sinensis ID: 038553


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
AENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVEKFGGFKVENECMQRETVARILPDPEK
cccccccccHHHHHHccccccccEEEEccEEcHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHccccccc
cEcccccccHHHHHHccccccccEEEEccEEEEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHcccccc
aenlfggksdlllksnpiykkvpvllhdgkplceSTVIVNYidetwpsppllpscasERAKARFWADFIDKKVIDAVCNIWkskgkvpgtaKNEFIEILKQLVGAlgekdffggdsfgfvdVIAIPLTCWFYAVEkfggfkvenecmQRETVARILPDPEK
aenlfggksdlllksnpIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKskgkvpgtakNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVEKFGGFKVENECMQRetvarilpdpek
AENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKdffggdsfgfvdvIAIPLTCWFYAVEKFGGFKVENECMQRETVARILPDPEK
**********LLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVEKFGGFKVENECMQRETV*********
AENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKS**KVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVEKFGGFKVENECMQRETVA*ILP****
AENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVEKFGGFKVENECMQRETVARILPDPEK
*E*LFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVEKFGGFKVENECMQRETVARIL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVEKFGGFKVENECMQRETVARILPDPEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q8L7C9217 Glutathione S-transferase yes no 0.993 0.737 0.514 2e-44
P49332221 Probable glutathione S-tr N/A no 0.962 0.701 0.532 1e-43
Q03666221 Probable glutathione S-tr N/A no 0.962 0.701 0.538 1e-43
Q9ZRW8219 Glutathione S-transferase no no 0.993 0.730 0.514 1e-42
Q9SHH7221 Glutathione S-transferase no no 0.962 0.701 0.512 2e-42
P25317220 Probable glutathione S-tr N/A no 0.987 0.722 0.497 5e-41
P50471219 Probable glutathione S-tr N/A no 0.987 0.726 0.488 6e-41
Q9SHH6218 Glutathione S-transferase no no 0.956 0.706 0.506 3e-40
F4IA73222 Glutathione S-transferase no no 0.993 0.720 0.508 7e-40
Q8GYM1218 Glutathione S-transferase no no 0.987 0.729 0.491 8e-40
>sp|Q8L7C9|GSTUK_ARATH Glutathione S-transferase U20 OS=Arabidopsis thaliana GN=GSTU20 PE=1 SV=1 Back     alignment and function desciption
 Score =  178 bits (451), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 113/171 (66%), Gaps = 11/171 (6%)

Query: 2   ENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSP-PLLPSCASERA 60
           E  F  KS LLL+SNPI+KK+PVL+H+GKP+CES  +V Y+DE WP   P  PS    RA
Sbjct: 34  EEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRA 93

Query: 61  KARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFV 120
           +ARFWADF+DKK  DA   +W  KG+     K EFIE +K L   LG+K +FGGDSFG+V
Sbjct: 94  QARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYV 153

Query: 121 DVIAIPLTCWFYAVEKFGGFKVENE----------CMQRETVARILPDPEK 161
           D+  I  + WF A EKFG F +E+E          CM++E+V++ LPD EK
Sbjct: 154 DISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEK 204




Exhibits glutathione-dependent thiol transferase activities. Can use glutathione (GSH) and 1-chloro-2,4-dinitrobenzene (CDNB) as substrates. Involved in the regulation of far-red light influence on development.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8
>sp|P49332|GSTXC_TOBAC Probable glutathione S-transferase parC OS=Nicotiana tabacum GN=PARC PE=2 SV=1 Back     alignment and function description
>sp|Q03666|GSTX4_TOBAC Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9ZRW8|GSTUJ_ARATH Glutathione S-transferase U19 OS=Arabidopsis thaliana GN=GSTU19 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHH7|GSTUP_ARATH Glutathione S-transferase U25 OS=Arabidopsis thaliana GN=GSTU25 PE=2 SV=1 Back     alignment and function description
>sp|P25317|GSTXA_TOBAC Probable glutathione S-transferase parA OS=Nicotiana tabacum GN=PARA PE=2 SV=1 Back     alignment and function description
>sp|P50471|GSTX1_NICPL Probable glutathione S-transferase MSR-1 OS=Nicotiana plumbaginifolia GN=MSR-1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHH6|GSTUO_ARATH Glutathione S-transferase U24 OS=Arabidopsis thaliana GN=GSTU24 PE=2 SV=1 Back     alignment and function description
>sp|F4IA73|GSTUL_ARATH Glutathione S-transferase U21 OS=Arabidopsis thaliana GN=GSTU21 PE=3 SV=1 Back     alignment and function description
>sp|Q8GYM1|GSTUM_ARATH Glutathione S-transferase U22 OS=Arabidopsis thaliana GN=GSTU22 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
283136086220 tau class glutathione transferase GSTU34 0.993 0.727 0.664 1e-61
255571271220 glutathione s-transferase, putative [Ric 0.993 0.727 0.688 4e-61
225466235220 PREDICTED: probable glutathione S-transf 0.993 0.727 0.676 1e-60
283136088220 tau class glutathione transferase GSTU35 0.993 0.727 0.658 3e-60
224079658220 predicted protein [Populus trichocarpa] 0.993 0.727 0.652 6e-60
356553231221 PREDICTED: probable glutathione S-transf 0.993 0.723 0.588 9e-53
356500987221 PREDICTED: probable glutathione S-transf 0.993 0.723 0.594 1e-52
357491765221 Glutathione S-transferase [Medicago trun 0.993 0.723 0.570 4e-48
449467551224 PREDICTED: probable glutathione S-transf 0.993 0.714 0.614 3e-47
12329923219 glutathione S-transferase [Cichorium int 0.993 0.730 0.534 3e-46
>gi|283136086|gb|ADB11362.1| tau class glutathione transferase GSTU34 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 136/170 (80%), Gaps = 10/170 (5%)

Query: 2   ENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAK 61
           E+LFGGKS+LLLKSNP+Y+KVPVLLH+GKPL ES +IV YIDE WPSPPLLP+CA  R++
Sbjct: 36  EDLFGGKSELLLKSNPVYQKVPVLLHNGKPLNESAIIVGYIDEKWPSPPLLPACAYGRSQ 95

Query: 62  ARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVD 121
           ARFWAD+IDKKVIDA C +W+S G+    AK +FIE+LK L  ALGEK FFGG++FGFVD
Sbjct: 96  ARFWADYIDKKVIDATCTVWRSTGEAVEVAKKDFIEVLKVLEEALGEKTFFGGETFGFVD 155

Query: 122 VIAIPLTCWFYAVEKFGGFKVENEC----------MQRETVARILPDPEK 161
           ++AIP+  WFYA EKFG F VE EC          MQRE+VA++LPDPEK
Sbjct: 156 IVAIPMASWFYASEKFGNFTVEAECPKLSAWIKRSMQRESVAKVLPDPEK 205




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255571271|ref|XP_002526585.1| glutathione s-transferase, putative [Ricinus communis] gi|223534079|gb|EEF35797.1| glutathione s-transferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225466235|ref|XP_002268911.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera] gi|147842244|emb|CAN69519.1| hypothetical protein VITISV_025521 [Vitis vinifera] gi|297738142|emb|CBI27343.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|283136088|gb|ADB11363.1| tau class glutathione transferase GSTU35 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224079658|ref|XP_002305905.1| predicted protein [Populus trichocarpa] gi|222848869|gb|EEE86416.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553231|ref|XP_003544961.1| PREDICTED: probable glutathione S-transferase-like [Glycine max] Back     alignment and taxonomy information
>gi|356500987|ref|XP_003519311.1| PREDICTED: probable glutathione S-transferase-like [Glycine max] Back     alignment and taxonomy information
>gi|357491765|ref|XP_003616170.1| Glutathione S-transferase [Medicago truncatula] gi|23092255|gb|AAN08609.1| glutathione-S-transferse-like protein [Medicago truncatula] gi|355517505|gb|AES99128.1| Glutathione S-transferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449467551|ref|XP_004151486.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus] gi|449523353|ref|XP_004168688.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|12329923|emb|CAC24549.1| glutathione S-transferase [Cichorium intybus x Cichorium endivia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
TAIR|locus:2032020217 GSTU20 "AT1G78370" [Arabidopsi 0.993 0.737 0.461 1.9e-35
TAIR|locus:2020312221 GSTU25 "AT1G17180" [Arabidopsi 0.956 0.696 0.472 1.7e-34
TAIR|locus:2032100219 GSTU19 "AT1G78380" [Arabidopsi 0.956 0.703 0.484 3.6e-34
TAIR|locus:2020322218 GSTU24 "AT1G17170" [Arabidopsi 0.981 0.724 0.467 3.2e-33
TAIR|locus:2101114227 GSTU27 "AT3G43800" [Arabidopsi 0.993 0.704 0.448 6.7e-33
TAIR|locus:2032025222 GSTU21 "AT1G78360" [Arabidopsi 0.993 0.720 0.456 5.4e-31
TAIR|locus:2032030218 GSTU22 "AT1G78340" [Arabidopsi 0.987 0.729 0.438 6.9e-31
TAIR|locus:2032035220 GSTU23 "AT1G78320" [Arabidopsi 0.987 0.722 0.426 7.9e-30
TAIR|locus:2024857224 GSTU28 "AT1G53680" [Arabidopsi 0.987 0.709 0.433 2.1e-29
TAIR|locus:2020302220 GSTU26 "AT1G17190" [Arabidopsi 0.956 0.7 0.387 1.5e-28
TAIR|locus:2032020 GSTU20 "AT1G78370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 1.9e-35, P = 1.9e-35
 Identities = 79/171 (46%), Positives = 101/171 (59%)

Query:     2 ENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSP-PLLPSCASERA 60
             E  F  KS LLL+SNPI+KK+PVL+H+GKP+CES  +V Y+DE WP   P  PS    RA
Sbjct:    34 EEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRA 93

Query:    61 KARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKXXXXXXXXXXX 120
             +ARFWADF+DKK  DA   +W  KG+     K EFIE +K L   LG+K           
Sbjct:    94 QARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYV 153

Query:   121 XXIAIPLTCWFYAVEKFGGFKVENE----------CMQRETVARILPDPEK 161
                 I  + WF A EKFG F +E+E          CM++E+V++ LPD EK
Sbjct:   154 DISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEK 204




GO:0004364 "glutathione transferase activity" evidence=ISS;IMP
GO:0005737 "cytoplasm" evidence=ISM;IDA;NAS
GO:0009407 "toxin catabolic process" evidence=TAS
GO:0005634 "nucleus" evidence=IDA
GO:0019899 "enzyme binding" evidence=IPI
GO:2000030 "regulation of response to red or far red light" evidence=IMP
GO:0009507 "chloroplast" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TAIR|locus:2020312 GSTU25 "AT1G17180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032100 GSTU19 "AT1G78380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020322 GSTU24 "AT1G17170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101114 GSTU27 "AT3G43800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032025 GSTU21 "AT1G78360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032030 GSTU22 "AT1G78340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032035 GSTU23 "AT1G78320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024857 GSTU28 "AT1G53680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020302 GSTU26 "AT1G17190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L7C9GSTUK_ARATH2, ., 5, ., 1, ., 1, 80.51460.99370.7373yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023461001
SubName- Full=Putative uncharacterized protein (Chromosome undetermined scaffold_30, whole genome shotgun sequence); (220 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
cd03185127 cd03185, GST_C_Tau, C-terminal, alpha helical doma 1e-36
cd0305874 cd03058, GST_N_Tau, GST_N family, Class Tau subfam 7e-22
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 2e-14
PRK09481211 PRK09481, sspA, stringent starvation protein A; Pr 9e-12
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 3e-11
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 2e-09
pfam0279874 pfam02798, GST_N, Glutathione S-transferase, N-ter 4e-09
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 1e-07
PRK15113214 PRK15113, PRK15113, glutathione S-transferase; Pro 3e-07
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 6e-06
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 9e-06
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 3e-05
PRK10542201 PRK10542, PRK10542, glutathionine S-transferase; P 0.001
cd03184124 cd03184, GST_C_Omega, C-terminal, alpha helical do 0.001
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 0.002
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 0.002
cd0304273 cd03042, GST_N_Zeta, GST_N family, Class Zeta subf 0.003
cd0304676 cd03046, GST_N_GTT1_like, GST_N family, Saccharomy 0.004
>gnl|CDD|198294 cd03185, GST_C_Tau, C-terminal, alpha helical domain of Class Tau Glutathione S-transferases Back     alignment and domain information
 Score =  122 bits (308), Expect = 1e-36
 Identities = 45/117 (38%), Positives = 64/117 (54%), Gaps = 13/117 (11%)

Query: 58  ERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGE-KDFFGGDS 116
           ERA+ARFWA +ID K+  A   +W +KG+    A  E +E LK L   L   K FFGGD+
Sbjct: 3   ERAQARFWAAYIDDKLFPAGRKVWAAKGEEQEKAVEEALEALKVLEEELKGGKPFFGGDT 62

Query: 117 FGFVDVIAIPLTCWFYAVEKFGGFKVENE------------CMQRETVARILPDPEK 161
            G++D+       WF A+E+ GG K+ +E             ++RE V  +LPD +K
Sbjct: 63  IGYLDIALGSFLGWFKAIEEVGGVKLLDEEKFPLLAAWAERFLEREAVKEVLPDRDK 119


Glutathione S-transferase (GST) C-terminal domain family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The plant-specific class Tau GST subfamily has undergone extensive gene duplication. The Arabidopsis and Oryza genomes contain 28 and 40 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Phi GSTs, showing class specificity in substrate preference. Tau enzymes are highly efficient in detoxifying diphenylether and aryloxyphenoxypropionate herbicides. In addition, Tau GSTs play important roles in intracellular signalling, biosynthesis of anthocyanin, responses to soil stresses and responses to auxin and cytokinin hormones. Length = 127

>gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236537 PRK09481, sspA, stringent starvation protein A; Provisional Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|198293 cd03184, GST_C_Omega, C-terminal, alpha helical domain of Class Omega Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
PRK09481211 sspA stringent starvation protein A; Provisional 99.97
KOG0406231 consensus Glutathione S-transferase [Posttranslati 99.97
PRK10542201 glutathionine S-transferase; Provisional 99.96
PLN02395215 glutathione S-transferase 99.96
PRK15113214 glutathione S-transferase; Provisional 99.95
PLN02473214 glutathione S-transferase 99.95
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.95
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.94
PRK10357202 putative glutathione S-transferase; Provisional 99.94
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.94
PRK11752264 putative S-transferase; Provisional 99.94
PLN02378213 glutathione S-transferase DHAR1 99.93
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.93
KOG0868217 consensus Glutathione S-transferase [Posttranslati 99.93
PLN02817265 glutathione dehydrogenase (ascorbate) 99.92
PTZ00057205 glutathione s-transferase; Provisional 99.91
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.9
PRK10387210 glutaredoxin 2; Provisional 99.86
KOG1695206 consensus Glutathione S-transferase [Posttranslati 99.84
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.81
KOG4420325 consensus Uncharacterized conserved protein (Gangl 99.77
PLN02907 722 glutamate-tRNA ligase 99.76
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 99.75
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.58
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.58
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.54
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.51
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.48
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.47
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 99.47
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 99.46
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.45
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.44
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.42
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.42
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 99.41
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 99.4
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 99.39
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.39
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 99.37
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 99.37
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 99.36
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 99.33
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 99.32
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.31
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 99.31
KOG3027257 consensus Mitochondrial outer membrane protein Met 99.3
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.3
KOG2903319 consensus Predicted glutathione S-transferase [Pos 99.29
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.29
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 99.27
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 99.25
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.21
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.2
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.16
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.15
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.14
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.13
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.12
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 99.12
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.11
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.1
KOG4244281 consensus Failed axon connections (fax) protein/gl 99.1
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.08
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.07
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.07
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.05
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.04
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 99.03
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 99.03
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.03
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.01
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 99.01
KOG3029370 consensus Glutathione S-transferase-related protei 99.0
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.98
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 98.98
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 98.97
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 98.96
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 98.96
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 98.93
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 98.92
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 98.91
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 98.91
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 98.9
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.9
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 98.89
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 98.83
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 98.82
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 98.82
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 98.82
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 98.79
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 98.77
KOG3028313 consensus Translocase of outer mitochondrial membr 98.74
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 98.74
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 98.73
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 98.71
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.54
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 98.54
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 98.49
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 98.46
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.39
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.39
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 98.36
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.33
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 97.83
KOG1147 712 consensus Glutamyl-tRNA synthetase [Translation, r 97.01
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 96.78
PF1056872 Tom37: Outer mitochondrial membrane transport comp 96.36
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 95.81
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 94.99
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 94.11
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 93.92
PRK1063883 glutaredoxin 3; Provisional 92.93
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 90.56
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 89.7
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 89.37
PF09635122 MetRS-N: MetRS-N binding domain; InterPro: IPR0182 88.12
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 86.53
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
Probab=99.97  E-value=2.3e-31  Score=191.01  Aligned_cols=157  Identities=24%  Similarity=0.399  Sum_probs=130.6

Q ss_pred             CCCCCCCChhhhhhCCCCCccceEEeCCeecccHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHHHHhhhhhhhhhhhh
Q 038553            2 ENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCNIW   81 (161)
Q Consensus         2 e~~~~~~~~~~~~~np~~~~vP~L~~~~~~l~eS~~I~~yl~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (161)
                      .+++++++++|+++||. |+||+|++||.+|+||.+|++||+++||+..++|.++.++++++.|+.+....+......+.
T Consensus        40 ~v~~~~~~~~~~~~nP~-g~VPvL~~~g~~l~ES~AIl~YL~~~~~~~~l~p~~~~~ra~~~~~~~~~~~~~~~~~~~~~  118 (211)
T PRK09481         40 QVEKDNLPQDLIDLNPY-QSVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLMMHRIEKDWYSLMNKIV  118 (211)
T ss_pred             eCCcccCCHHHHHhCCC-CCCCEEEECCEEeeCHHHHHHHHHHhCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            56778889999999999 99999999999999999999999999998889999999999999999887665554443333


Q ss_pred             hcCCCchhhhHHHHHHHHHHHHHHhCCCCcccCCCCChhHHhHHHHHHHHHHhh------hhCCCCc-hhhhhchhhhhh
Q 038553           82 KSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAVE------KFGGFKV-ENECMQRETVAR  154 (161)
Q Consensus        82 ~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~aD~~~~~~l~~~~~~~------~~~~~~~-~~~~~~rp~~~~  154 (161)
                      ...+...+...+.+...++.+|+.|++++|++|+++|+||+++++++.++...+      .+|++.. .++|.+||++++
T Consensus       119 ~~~~~~~~~~~~~l~~~l~~le~~L~~~~~l~G~~~t~AD~~l~~~~~~~~~~~~~~~~~~~p~l~~w~~~~~~rp~~~~  198 (211)
T PRK09481        119 NGSASEADAARKQLREELLAIAPVFGEKPYFMSEEFSLVDCYLAPLLWRLPVLGIELSGPGAKELKGYMTRVFERDSFLA  198 (211)
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHHHhccCCcccCCCccHHHHHHHHHHHHHHhcCCCCCCCCChhHHHHHHHHhccHHHHH
Confidence            223344566778899999999999998999999999999999999998765432      2455555 699999999999


Q ss_pred             hCCCC
Q 038553          155 ILPDP  159 (161)
Q Consensus       155 ~~~~~  159 (161)
                      ++...
T Consensus       199 ~~~~~  203 (211)
T PRK09481        199 SLTEA  203 (211)
T ss_pred             HcCHH
Confidence            98754



>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
2vo4_A219 Glutathione Transferase From Glycine Max Length = 2 7e-35
1oyj_A231 Crystal Structure Solution Of Rice Gst1 (Osgstu1) I 9e-29
4j2f_A223 Crystal Structure Of A Glutathione Transferase Fami 1e-23
1gwc_A230 The Structure Of A Tau Class Glutathione S-Transfer 6e-18
1yy7_A213 Crystal Structure Of Stringent Starvation Protein A 8e-06
1fw1_A216 Glutathione Transferase ZetaMALEYLACETOACETATE ISOM 1e-05
3lyp_A215 Structure Of Stringent Starvation Protein A Homolog 2e-05
4hoj_A210 Crystal Structure Of Glutathione Transferase Homolo 7e-05
2cz2_A223 Crystal Structure Of Glutathione Transferase Zeta 1 3e-04
4isd_A220 Crystal Structure Of Glutathione Transferase Homolo 3e-04
3mdk_A217 Structure Of Stringent Starvation Protein A (Sspa) 5e-04
3cbu_A214 Crystal Structure Of A Putative Glutathione S-Trans 6e-04
>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 Back     alignment and structure

Iteration: 1

Score = 142 bits (359), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 75/166 (45%), Positives = 99/166 (59%), Gaps = 11/166 (6%) Query: 7 GKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETW-PSPPLLPSCASERAKARFW 65 KS LLL+ NP++KK+PVL+H+GKP+CES + V YI+E W PLLPS +RA+ RFW Sbjct: 39 NKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFW 98 Query: 66 ADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKXXXXXXXXXXXXXIAI 125 AD++DKK+ D IW SKG+ AK EFIE LK L LG+K + Sbjct: 99 ADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALV 158 Query: 126 PLTCWFYAVEKFGGFKVENE----------CMQRETVARILPDPEK 161 P WF A E FG +E+E C+Q+E+VA+ LPD +K Sbjct: 159 PFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQK 204
>pdb|1OYJ|A Chain A, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In Complex With Glutathione. Length = 231 Back     alignment and structure
>pdb|4J2F|A Chain A, Crystal Structure Of A Glutathione Transferase Family Member From Ricinus Communis, Target Efi-501866 Length = 223 Back     alignment and structure
>pdb|1GWC|A Chain A, The Structure Of A Tau Class Glutathione S-Transferase From Wheat, Active In Herbicide Detoxification Length = 230 Back     alignment and structure
>pdb|1YY7|A Chain A, Crystal Structure Of Stringent Starvation Protein A (Sspa), An Rna Polymerase-Associated Transcription Factor Length = 213 Back     alignment and structure
>pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 Back     alignment and structure
>pdb|3LYP|A Chain A, Structure Of Stringent Starvation Protein A Homolog From Pseudomonas Fluorescens Length = 215 Back     alignment and structure
>pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 Back     alignment and structure
>pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 Back     alignment and structure
>pdb|4ISD|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Burkholderia Gl Bgr1, Target Efi-501803, With Bound Glutathione Length = 220 Back     alignment and structure
>pdb|3MDK|A Chain A, Structure Of Stringent Starvation Protein A (Sspa) From Pseudomonas Putida Length = 217 Back     alignment and structure
>pdb|3CBU|A Chain A, Crystal Structure Of A Putative Glutathione S-Transferase (Reut_a1011) From Ralstonia Eutropha Jmp134 At 2.05 A Resolution Length = 214 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 3e-64
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 3e-59
4dej_A231 Glutathione S-transferase related protein; transfe 3e-58
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 9e-58
3lyk_A216 Stringent starvation protein A homolog; structural 2e-57
3lyp_A215 Stringent starvation protein A; structural genomic 7e-57
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 1e-54
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 2e-54
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 3e-53
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 1e-52
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 1e-49
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 4e-49
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 3e-47
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 1e-44
3lxz_A229 Glutathione S-transferase family protein; structur 4e-47
3niv_A222 Glutathione S-transferase; structural genomics, PS 4e-44
3tou_A226 Glutathione S-transferase protein; GSH binding sit 1e-43
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 7e-42
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 1e-39
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 2e-36
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 1e-32
2r4v_A247 XAP121, chloride intracellular channel protein 2; 4e-32
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 5e-31
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 6e-31
2ahe_A267 Chloride intracellular channel protein 4; glutathi 3e-30
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 2e-25
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 8e-22
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 4e-21
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 5e-19
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 2e-18
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 3e-17
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 9e-15
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 5e-14
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 7e-14
3n5o_A235 Glutathione transferase; seattle structural genomi 9e-14
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 1e-12
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 1e-12
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 3e-12
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 5e-12
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 7e-12
1f2e_A201 Glutathione S-transferase; GST complexed with glut 5e-11
1axd_A209 Glutathione S-transferase I; transferase, herbicid 6e-11
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 5e-10
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 5e-10
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 6e-10
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 1e-09
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 1e-09
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 3e-09
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 5e-09
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 6e-09
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 1e-08
1r5a_A218 Glutathione transferase; glutathione S-transferase 1e-08
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 2e-08
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 7e-08
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 8e-08
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 2e-07
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 3e-07
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 4e-07
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 6e-07
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 6e-07
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 1e-06
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 1e-06
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 1e-06
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 2e-06
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 3e-06
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 3e-06
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 4e-06
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 8e-06
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 8e-06
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 9e-06
2fhe_A216 GST, glutathione S-transferase; transferase-substr 1e-05
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 1e-05
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 1e-05
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 1e-05
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 2e-05
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 3e-05
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 3e-05
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 3e-05
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 4e-05
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 4e-05
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 5e-05
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 8e-05
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 9e-05
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 9e-05
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 2e-04
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
 Score =  194 bits (496), Expect = 3e-64
 Identities = 84/171 (49%), Positives = 111/171 (64%), Gaps = 12/171 (7%)

Query: 2   ENLFGGKSDLLLKSNPIYKKVPVLLHDGKPLCESTVIVNYIDETWPS-PPLLPSCASERA 60
           E+L   KS LLL+ NP++KK+PVL+H+GKP+CES + V YI+E W    PLLPS   +RA
Sbjct: 35  EDLRN-KSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPSDPYQRA 93

Query: 61  KARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFV 120
           + RFWAD++DKK+ D    IW SKG+    AK EFIE LK L   LG+K +FGGD+ GFV
Sbjct: 94  QTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFV 153

Query: 121 DVIAIPLTCWFYAVEKFGGFKVE----------NECMQRETVARILPDPEK 161
           D+  +P   WF A E FG   +E            C+Q+E+VA+ LPD +K
Sbjct: 154 DIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQK 204


>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
4glt_A225 Glutathione S-transferase-like protein; structural 100.0
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.98
3lyk_A216 Stringent starvation protein A homolog; structural 99.97
3lyp_A215 Stringent starvation protein A; structural genomic 99.97
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.97
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.97
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.97
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.97
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.97
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.97
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.97
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.97
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.97
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.96
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.96
4dej_A231 Glutathione S-transferase related protein; transfe 99.96
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.96
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.96
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.96
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.96
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.96
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.96
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.96
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.96
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.96
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.96
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.96
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.96
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.96
3lxz_A229 Glutathione S-transferase family protein; structur 99.96
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.96
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.96
3n5o_A235 Glutathione transferase; seattle structural genomi 99.96
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.96
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.96
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.96
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.96
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.96
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.96
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.96
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.96
4exj_A238 Uncharacterized protein; transferase-like protein, 99.96
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.96
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.96
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.96
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.96
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.96
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.95
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.95
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.95
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.95
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.95
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.95
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.95
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.95
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.95
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.95
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.95
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.95
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.95
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.95
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.95
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.95
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.95
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.95
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.95
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.95
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.95
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.94
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.94
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.94
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.94
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.94
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.94
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.94
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.94
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.94
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.94
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.94
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.94
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.94
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.94
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.94
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.94
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.94
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.94
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.94
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.94
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.94
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.94
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.94
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.94
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.94
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.93
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.93
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.93
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.93
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.93
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.92
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.92
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.92
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.91
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.91
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.9
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.9
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.9
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.89
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.87
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.87
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.87
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.82
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.81
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.77
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.77
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 98.91
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 96.62
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 95.99
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 94.73
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 94.34
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 86.86
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 85.26
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 85.22
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
Probab=100.00  E-value=1.8e-32  Score=197.23  Aligned_cols=157  Identities=21%  Similarity=0.347  Sum_probs=135.2

Q ss_pred             CCCCCCCCChhhhhhCCCCCccceEE-eCCeecccHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHHHHhhhhhhhhhh
Q 038553            1 AENLFGGKSDLLLKSNPIYKKVPVLL-HDGKPLCESTVIVNYIDETWPSPPLLPSCASERAKARFWADFIDKKVIDAVCN   79 (161)
Q Consensus         1 ~e~~~~~~~~~~~~~np~~~~vP~L~-~~~~~l~eS~~I~~yl~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (161)
                      ++|++..++++|+++||. |+||+|+ +||.+|+||.+|++||++++|++.++|.++.++++++.|+.+..+.+...+..
T Consensus        51 ~~v~~~~~~~~~~~~nP~-gkVPvL~~~dG~~l~ES~aI~~YL~~~~~~~~l~p~~~~~ra~~~~~~~~~~~~~~~~~~~  129 (225)
T 4glt_A           51 VLVVLADPECPVADHNPL-GKIPVLILPDGESLYDSRVIVEYLDHRTPVAHLIPQDHTAKIAVRRWEALADGVTDAAVAA  129 (225)
T ss_dssp             EECCTTCSSSCGGGTCTT-CCSCEEECTTSCEECSHHHHHHHHHTTCSSCCSSCSSHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEeCCCCCCHHHHHhCCC-CCCCEEEeCCCCEEeehHHHHHHHHHhCCccccCCchhHHHHHHHHHHHHHhcccchHHHH
Confidence            468889999999999999 9999999 47799999999999999999999999999999999999999999988887766


Q ss_pred             hhhcC-------CCchhhhHHHHHHHHHHHHHHhCCCCcccCCCCChhHHhHHHHHHHHHHh-------hhhCCCCc-hh
Q 038553           80 IWKSK-------GKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLTCWFYAV-------EKFGGFKV-EN  144 (161)
Q Consensus        80 ~~~~~-------~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~aD~~~~~~l~~~~~~-------~~~~~~~~-~~  144 (161)
                      ++...       ....+...+.+.+.|+.||+.|++++|++|+++|+||+++++++.++...       ..+|++.. .+
T Consensus       130 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~Gd~~t~ADi~l~~~l~~~~~~~~~~~~~~~~P~l~~w~~  209 (225)
T 4glt_A          130 VMEGRRPEGMQDSAVIEKQLNKVERGLRRMDQDLEKRKWCVNESFSLADIAVGCMLGYLELRYQHLDWKQQYPNLARHYA  209 (225)
T ss_dssp             HHHHTSCSSSCCHHHHHHHHHHHHHHHHHHHHHTTTCSSSSTTSCCHHHHHHHHHHHHHHHHCTTCCHHHHCHHHHHHHH
T ss_pred             HHHhhccccchhHHHHHHHHHHHHHHHHHHHHHHhcCCcccCCcccHhHHHHHHHHHHHHHhcCCCCccccCHHHHHHHH
Confidence            65321       12345667889999999999999999999999999999999999887642       23555555 69


Q ss_pred             hhhchhhhhhhCCC
Q 038553          145 ECMQRETVARILPD  158 (161)
Q Consensus       145 ~~~~rp~~~~~~~~  158 (161)
                      +|.+||+||+++|.
T Consensus       210 r~~~rPs~k~t~P~  223 (225)
T 4glt_A          210 AMMKRASFKDTAPV  223 (225)
T ss_dssp             HHHTCHHHHTTCCC
T ss_pred             HHHCCHHHHHhCCC
Confidence            99999999999885



>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1oyja1145 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat 7e-30
d1gwca1138 a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch 1e-22
d1eema1139 a.45.1.1 (A:103-241) Class omega GST {Human (Homo 2e-14
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 6e-13
d1e6ba1133 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres 2e-12
d1fw1a1125 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa 1e-11
d1pmta1121 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi 8e-08
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 1e-07
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 2e-07
d1nhya1144 a.45.1.1 (A:76-219) GST-like domain of elongation 2e-06
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 2e-06
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 4e-06
d1z9ha1161 a.45.1.1 (A:213-373) Microsomal prostaglandin E sy 4e-06
d1n2aa1121 a.45.1.1 (A:81-201) Class beta GST {Escherichia co 6e-06
d1f2ea1121 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p 9e-06
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 1e-05
d1f2ea280 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau 2e-05
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 3e-05
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 3e-05
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 4e-05
d1aw9a1135 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays 6e-05
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 6e-05
d1k0ma286 c.47.1.5 (A:6-91) Chloride intracellular channel 1 1e-04
d1n2aa280 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli 2e-04
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 2e-04
d1axda1129 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays 2e-04
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 3e-04
d1k0ma1149 a.45.1.1 (A:92-240) Chloride intracellular channel 8e-04
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 0.002
d2cvda1124 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s 0.002
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 0.003
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 0.003
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 0.004
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class tau GST
species: Rice (Oryza sativa) [TaxId: 4530]
 Score =  104 bits (260), Expect = 7e-30
 Identities = 51/128 (39%), Positives = 70/128 (54%), Gaps = 13/128 (10%)

Query: 47  PSPPLLPSCASERAKARFWADFIDKKVIDAVCNIWKSKGKVPGTAKNEFIEILKQLVGAL 106
           P+       A  RA ARFWAD++D+K+ D    +W+ KG+    A  E  EIL+ L   L
Sbjct: 4   PANSGDADAAYARATARFWADYVDRKLYDCGSRLWRLKGEPQAAAGREMAEILRTLEAEL 63

Query: 107 GEKDFFGG---DSFGFVDVIAIPLTCWFYAVEKFGGFKVE----------NECMQRETVA 153
           G+++FFGG      GFVDV  +P T WFY+ E+ GGF VE            C + ++V 
Sbjct: 64  GDREFFGGGGGGRLGFVDVALVPFTAWFYSYERCGGFSVEEVAPRLAAWARRCGRIDSVV 123

Query: 154 RILPDPEK 161
           + LP PEK
Sbjct: 124 KHLPSPEK 131


>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.77
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.76
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.74
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.72
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.71
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.7
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.69
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.69
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.68
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.68
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.67
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.67
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.66
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.66
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.66
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.65
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.65
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.65
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.64
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.64
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.64
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.64
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.63
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.63
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.63
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.62
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.61
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.58
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.58
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 99.57
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.51
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.5
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.48
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.46
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.45
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.45
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.45
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.45
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.44
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.43
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.4
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.4
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.4
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 99.39
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.35
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.33
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.32
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.27
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.23
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.19
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.15
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.13
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.13
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.12
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.12
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.1
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.09
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.09
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.09
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 99.09
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.08
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.08
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.0
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.0
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 98.91
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.87
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.61
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 98.39
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 98.33
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 97.95
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 94.86
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 88.43
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class beta GST
species: Escherichia coli [TaxId: 562]
Probab=99.77  E-value=5.8e-19  Score=113.65  Aligned_cols=108  Identities=19%  Similarity=0.344  Sum_probs=91.6

Q ss_pred             CCCCCHHHHHHHHHHHHHHhhhhhhhhhhhhhcC--CCchhhhHHHHHHHHHHHHHHhCCCCcccCCCCChhHHhHHHHH
Q 038553           51 LLPSCASERAKARFWADFIDKKVIDAVCNIWKSK--GKVPGTAKNEFIEILKQLVGALGEKDFFGGDSFGFVDVIAIPLT  128 (161)
Q Consensus        51 l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~aD~~~~~~l  128 (161)
                      +.|.++.+|+++++|+.|+.+.+++.+..++...  +...+...+.+.+.++.+|+.|++++|++|+++|+||+++++++
T Consensus         3 l~P~~~~~Ra~~~~wl~~~~~~l~~~~~~~f~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~yl~Gd~~s~ADi~l~~~~   82 (121)
T d1n2aa1           3 LAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEEYKPTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVL   82 (121)
T ss_dssp             SCCTTCHHHHHHHHHHHHHHHHTHHHHHHHHCSSSCGGGHHHHHHHHHHHHHHHHHHTTTSSCSSSSSCCHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHhchHHHHHHHHCcCCCHHHHHHHHHHHHHHHHHHHHHHccCCCcccccccHHHHHHHHHH
Confidence            5677888999999999999999999888877654  45567778889999999999999999999999999999999999


Q ss_pred             HHHHHhh----hhCCCCc-hhhhhchhhhhhhCCC
Q 038553          129 CWFYAVE----KFGGFKV-ENECMQRETVARILPD  158 (161)
Q Consensus       129 ~~~~~~~----~~~~~~~-~~~~~~rp~~~~~~~~  158 (161)
                      .|....+    .+|++.. .++|.+||++++++..
T Consensus        83 ~~~~~~~~~~~~~p~l~~w~~ri~~rpav~~~l~~  117 (121)
T d1n2aa1          83 RWAYAVKLNLEGLEHIAAFMQRMAERPEVQDALSA  117 (121)
T ss_dssp             HHHHHTTCCCTTCHHHHHHHHHHHTSHHHHHHHHH
T ss_pred             HHHHHcCCCcccCHHHHHHHHHHHCCHHHHHHHHH
Confidence            9887653    3444444 6999999999998754



>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure