Citrus Sinensis ID: 038571

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MEPGSNDKHEDGSSLPNGYNEEQAIDGNTDDRSKTARNPRWTRQETIVLIQGKRVVEDRIRGFRTSTSAFRSDHSEPKWDSVASYCKQYGVNRRPVQCRKRWGNLLVDFRKIKRWESQMKEEKQSFWVMRNESRKQMKLPGYFDREVYDVLDGVLAMPAVPLTTMSVSEEDEDDEVFDSDRSTAAGDGLFSDSEPSQRQEISHNPEKETTERQSPSKKVAAQLHVADTLKEKLAGTTTANGSTTQERWKRRRLSSCVSKETNMGDLLFKVLERNSSMLNTQLEAQNINCQLDREQKKEHSDNLIAAMNKLTDALLRIGNKL
ccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
****************************************WTRQETIVLIQGKRVVEDRI******************WDSVASYCKQYGVNRRPVQCRKRWGNLLVDFRKIKRWES*******SFWVMR****KQMKLPGYFDREVYDVLDGVLAMP********************************************************************************************************MGDLLFKVLE***************************SDNLIAAMNKLTDALLRIGNKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPGSNDKHEDGSSLPNGYNEEQAIDGNTDDRSKTARNPRWTRQETIVLIQGKRVVEDRIRGFRTSTSAFRSDHSEPKWDSVASYCKQYGVNRRPVQCRKRWGNLLVDFRKIKRWESQMKEEKQSFWVMRNESRKQMKLPGYFDREVYDVLDGVLAMPAVPLTTMSVSEEDEDDEVFDSDRSTAAGDGLFSDSEPSQRQEISHNPEKETTERQSPSKKVAAQLHVADTLKEKLAGTTTANGSTTQERWKRRRLSSCVSKETNMGDLLFKVLERNSSxxxxxxxxxxxxxxxxxxxxxEHSDNLIAAMNKLTDALLRIGNKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EBI, chain A
Confidence level:confident
Coverage over the Query: 35-127
View the alignment between query and template
View the model in PyMOL
Template: 2AJE, chain A
Confidence level:probable
Coverage over the Query: 34-62,77-109,128-150
View the alignment between query and template
View the model in PyMOL