Citrus Sinensis ID: 038614

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---

MGGHMRSHFAKHPISSSNINPSPPKYPSSSSSLSNMQTYRSVNNRPFSGLEDESEAESSRNLTKARSKRPLRTIESVSNSVTENFLSDREVAMCLLKLSRDNWLQKDKQVVVAEAVVDEDEYVRGKSDDGDNDEEEDKEEDESSLVSRTNKYKCKTCKKEFRSYQALGGHKASHKKIKIHHNGSSDAAAAGGDAVVMDQRVFKCPFCDKVFDSGQALGGHKKIHFTYLATPITKITSSAKSSGAKFIDLNLPAPEDDSEVSQV

cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*************************************************************************************LSDREVAMCLLKLSR***************************************************YKCKTCKKEFRSYQAL********************************RVFKCPFCDKVFDSGQALGGHKKIHF**********************DLNLPAPE********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger protein ZAT9	Probable transcription factor that may be involved in stress responses.	probable	Q9M202

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DMI, chain A
Confidence level:confident
Coverage over the Query: 113-205
View the alignment between query and template
View the model in PyMOL

Template: 2DMI, chain A
Confidence level:confident
Coverage over the Query: 137-228
View the alignment between query and template
View the model in PyMOL