Citrus Sinensis ID: 038626

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
LAGKPVANNHSEPQEIEASVPASSEKAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF
ccccccccccccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHccccccccc
ccccccccccccccccccccccccccccccEEEEEEccccHHHHHcHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHccEEccccccHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHccHHccc
lagkpvannhsepqeieasvpassekagstlsITFVGasgdlakkkIFPALFALYyedclpedftvfgyartklTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCfyhsglynseeHFAELDSKLKEKevgklsnrlfylsippniFVEVAKCASLRASSATGWTRVIVekpigrdskssgELTRSLKQYLREDQIF
lagkpvannhsepqeieasvpassekagsTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARtkltdeelrnVIRKTltcgidkkytklDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRassatgwtrvivekpigrdskssgeltrslkqylredqif
LAGKPVANNHSEPQEIEASVPASSEKAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF
******************************LSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEK**************************
******************************LSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRK***********KLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF
**************************AGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGR********TRSLKQYLREDQIF
***************************GSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLRE*Q**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LAGKPVANNHSEPQEIEASVPASSEKAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q43793 593 Glucose-6-phosphate 1-deh N/A no 0.959 0.318 0.704 1e-74
Q43727 576 Glucose-6-phosphate 1-deh yes no 0.873 0.298 0.777 1e-74
Q9FY99 596 Glucose-6-phosphate 1-deh no no 0.888 0.293 0.719 2e-72
Q8L743 599 Glucose-6-phosphate 1-deh no no 0.857 0.282 0.744 3e-71
O24357 574 Glucose-6-phosphate 1-deh N/A no 1.0 0.343 0.661 5e-71
Q43839 577 Glucose-6-phosphate 1-deh N/A no 0.918 0.313 0.702 1e-70
Q93ZW0 625 Glucose-6-phosphate 1-deh no no 0.857 0.270 0.465 1e-38
Q9LK23 516 Glucose-6-phosphate 1-deh no no 0.857 0.327 0.45 2e-33
Q42919 515 Glucose-6-phosphate 1-deh N/A no 0.857 0.328 0.447 3e-33
Q9FJI5 515 Glucose-6-phosphate 1-deh no no 0.832 0.318 0.444 9e-33
>sp|Q43793|G6PDC_TOBAC Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function desciption
 Score =  279 bits (713), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 158/196 (80%), Gaps = 7/196 (3%)

Query: 5   PVANNHSEPQEIEASVPASSEKAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDF 64
           PVA     P+E + ++   S KA ST+SIT VGASGDLAKKKIFPALFALYYE CLPE F
Sbjct: 88  PVA----PPKEQKDTIDFDSNKAKSTVSITVVGASGDLAKKKIFPALFALYYEGCLPEHF 143

Query: 65  TVFGYARTKLTDEELRNVIRKTLTCGIDKKYT---KLDQFLKRCFYHSGLYNSEEHFAEL 121
           T+FGYAR+K+TD ELRN++ KTLTC IDK+     K++QFL+RCFYHSG Y+S E+FAEL
Sbjct: 144 TIFGYARSKMTDAELRNMVSKTLTCRIDKRENCGEKMEQFLERCFYHSGQYDSLENFAEL 203

Query: 122 DSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSG 181
           D KLKE E G+ SNRLFYLSIPPNIF+   +CASL ASSA GWTRVIVEKP GRDS+SS 
Sbjct: 204 DKKLKEHEAGRFSNRLFYLSIPPNIFINAVRCASLSASSAHGWTRVIVEKPFGRDSESSA 263

Query: 182 ELTRSLKQYLREDQIF 197
            LTRSLKQYL EDQIF
Sbjct: 264 ALTRSLKQYLNEDQIF 279
Catalyzes the rate-limiting step of the oxidative pentose-phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis which are involved in membrane synthesis and cell division.
Nicotiana tabacum (taxid: 4097)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 9
>sp|Q43727|G6PD1_ARATH Glucose-6-phosphate 1-dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=APG1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FY99|G6PD2_ARATH Glucose-6-phosphate 1-dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=At5g13110 PE=2 SV=2 Back     alignment and function description
>sp|Q8L743|G6PD3_ARATH Glucose-6-phosphate 1-dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=At1g24280 PE=2 SV=2 Back     alignment and function description
>sp|O24357|G6PDC_SPIOL Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Spinacia oleracea GN=G6PD PE=2 SV=1 Back     alignment and function description
>sp|Q43839|G6PDC_SOLTU Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Solanum tuberosum PE=1 SV=1 Back     alignment and function description
>sp|Q93ZW0|G6PD4_ARATH Glucose-6-phosphate 1-dehydrogenase 4, chloroplastic OS=Arabidopsis thaliana GN=At1g09420 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK23|G6PD5_ARATH Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=ACG9 PE=2 SV=1 Back     alignment and function description
>sp|Q42919|G6PD_MEDSA Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|Q9FJI5|G6PD6_ARATH Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 2 OS=Arabidopsis thaliana GN=ACG12 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
356522804 588 PREDICTED: LOW QUALITY PROTEIN: glucose- 1.0 0.335 0.741 2e-79
449453209 594 PREDICTED: glucose-6-phosphate 1-dehydro 0.984 0.326 0.752 5e-78
255578725 593 glucose-6-phosphate 1-dehydrogenase, put 1.0 0.332 0.727 1e-76
356528894 588 PREDICTED: glucose-6-phosphate 1-dehydro 1.0 0.335 0.721 2e-76
225447549 584 PREDICTED: glucose-6-phosphate 1-dehydro 0.989 0.333 0.757 1e-74
296085025 1355 unnamed protein product [Vitis vinifera] 0.989 0.143 0.757 2e-74
297805130 578 glucose-6-phosphate dehydrogenase 1 [Ara 0.873 0.297 0.782 6e-74
224131858 571 predicted protein [Populus trichocarpa] 0.883 0.304 0.785 1e-73
380863004229 glucose-6-phosphate dehydrogenase, parti 0.822 0.707 0.830 1e-73
332371918 593 glucose-6-phosphate dehydrogenase [Nicot 0.959 0.318 0.698 2e-73
>gi|356522804|ref|XP_003530034.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 167/201 (83%), Gaps = 4/201 (1%)

Query: 1   LAGKPVANNHSEPQEIEASVP-ASSEKAGSTLSITFVGASGDLAKKKIFPALFALYYEDC 59
           LAG  +A    +PQ +E   P   SE  GS LSIT VGASGDLAKKKIFPALFAL+YED 
Sbjct: 72  LAGSSLAKEDGKPQPLEGPFPFPDSEYTGSNLSITVVGASGDLAKKKIFPALFALFYEDW 131

Query: 60  LPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYT---KLDQFLKRCFYHSGLYNSEE 116
           LPE+F VFG+ARTK+TDEELRN+I KTLTC IDK+     K+DQFLKRCFYHSG YNSE+
Sbjct: 132 LPENFLVFGFARTKMTDEELRNMISKTLTCRIDKRENCEDKMDQFLKRCFYHSGQYNSED 191

Query: 117 HFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRD 176
           HF+ELDSKL+EKE GKLSNRLFYLSIPPNIFV+V +CASL+ASS  GWTRVIVEKP GRD
Sbjct: 192 HFSELDSKLREKEGGKLSNRLFYLSIPPNIFVDVVRCASLKASSKDGWTRVIVEKPFGRD 251

Query: 177 SKSSGELTRSLKQYLREDQIF 197
           S+SS ELT+SLKQYL EDQIF
Sbjct: 252 SESSSELTKSLKQYLTEDQIF 272

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449453209|ref|XP_004144351.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255578725|ref|XP_002530221.1| glucose-6-phosphate 1-dehydrogenase, putative [Ricinus communis] gi|223530268|gb|EEF32168.1| glucose-6-phosphate 1-dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356528894|ref|XP_003533032.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|225447549|ref|XP_002268887.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085025|emb|CBI28440.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297805130|ref|XP_002870449.1| glucose-6-phosphate dehydrogenase 1 [Arabidopsis lyrata subsp. lyrata] gi|297316285|gb|EFH46708.1| glucose-6-phosphate dehydrogenase 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224131858|ref|XP_002321196.1| predicted protein [Populus trichocarpa] gi|222861969|gb|EEE99511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|380863004|gb|AFF18795.1| glucose-6-phosphate dehydrogenase, partial [Dimocarpus longan] Back     alignment and taxonomy information
>gi|332371918|dbj|BAK22409.1| glucose-6-phosphate dehydrogenase [Nicotiana benthamiana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
TAIR|locus:2165154 576 G6PD1 "glucose-6-phosphate deh 0.873 0.298 0.777 1e-68
TAIR|locus:2179887 596 G6PD2 "glucose-6-phosphate deh 0.913 0.302 0.706 1.7e-66
TAIR|locus:2032412 599 G6PD3 "glucose-6-phosphate deh 0.857 0.282 0.744 3.2e-65
TAIR|locus:2086558 516 G6PD5 "glucose-6-phosphate deh 0.868 0.331 0.453 1.1e-32
TAIR|locus:2154805 515 G6PD6 "glucose-6-phosphate deh 0.832 0.318 0.444 9.4e-32
DICTYBASE|DDB_G0273639 497 g6pd-2 "glucose 6-phosphate-1- 0.862 0.342 0.416 5.9e-29
DICTYBASE|DDB_G0273131 497 g6pd-1 "glucose 6-phosphate-1- 0.862 0.342 0.416 5.9e-29
MGI|MGI:105979 515 G6pdx "glucose-6-phosphate deh 0.817 0.312 0.401 6e-29
UNIPROTKB|G4MR82 507 MGG_09926 "Glucose-6-phosphate 0.913 0.355 0.401 9e-29
RGD|2645 515 G6pd "glucose-6-phosphate dehy 0.817 0.312 0.401 1.3e-28
TAIR|locus:2165154 G6PD1 "glucose-6-phosphate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 697 (250.4 bits), Expect = 1.0e-68, P = 1.0e-68
 Identities = 136/175 (77%), Positives = 152/175 (86%)

Query:    26 KAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRK 85
             K  STLSIT VGASGDLAKKKIFPALFAL+YE CLP+DF+VFGYARTKLT EELR++I  
Sbjct:    86 KGESTLSITVVGASGDLAKKKIFPALFALFYEGCLPQDFSVFGYARTKLTHEELRDMISS 145

Query:    86 TLTCGIDKKYT---KLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSI 142
             TLTC ID++     K++QFLKRCFYHSG YNSEE FAEL+ KLKEKE GK+SNRL+YLSI
Sbjct:   146 TLTCRIDQREKCGDKMEQFLKRCFYHSGQYNSEEDFAELNKKLKEKEAGKISNRLYYLSI 205

Query:   143 PPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF 197
             PPNIFV+V +CASLRASS  GWTRVIVEKP GRDS+SSGELTR LKQYL E+QIF
Sbjct:   206 PPNIFVDVVRCASLRASSENGWTRVIVEKPFGRDSESSGELTRCLKQYLTEEQIF 260
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004345 "glucose-6-phosphate dehydrogenase activity" evidence=IEA;ISS;IDA
GO:0006006 "glucose metabolic process" evidence=IEA;ISS;IDA
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009051 "pentose-phosphate shunt, oxidative branch" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009637 "response to blue light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
TAIR|locus:2179887 G6PD2 "glucose-6-phosphate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032412 G6PD3 "glucose-6-phosphate dehydrogenase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086558 G6PD5 "glucose-6-phosphate dehydrogenase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154805 G6PD6 "glucose-6-phosphate dehydrogenase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273639 g6pd-2 "glucose 6-phosphate-1-dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0273131 g6pd-1 "glucose 6-phosphate-1-dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:105979 G6pdx "glucose-6-phosphate dehydrogenase X-linked" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G4MR82 MGG_09926 "Glucose-6-phosphate 1-dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
RGD|2645 G6pd "glucose-6-phosphate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q43727G6PD1_ARATH1, ., 1, ., 1, ., 4, 90.77710.87300.2986yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
PLN02640 573 PLN02640, PLN02640, glucose-6-phosphate 1-dehydrog 1e-105
PLN02333 604 PLN02333, PLN02333, glucose-6-phosphate 1-dehydrog 1e-100
pfam00479183 pfam00479, G6PD_N, Glucose-6-phosphate dehydrogena 2e-69
PRK05722 495 PRK05722, PRK05722, glucose-6-phosphate 1-dehydrog 8e-55
PTZ00309 542 PTZ00309, PTZ00309, glucose-6-phosphate 1-dehydrog 8e-55
COG0364 483 COG0364, Zwf, Glucose-6-phosphate 1-dehydrogenase 3e-50
TIGR00871 482 TIGR00871, zwf, glucose-6-phosphate 1-dehydrogenas 8e-50
PLN02539 491 PLN02539, PLN02539, glucose-6-phosphate 1-dehydrog 2e-49
PRK12853 482 PRK12853, PRK12853, glucose-6-phosphate 1-dehydrog 3e-39
PRK12854 484 PRK12854, PRK12854, glucose-6-phosphate 1-dehydrog 7e-25
>gnl|CDD|215344 PLN02640, PLN02640, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information 
 Score =  314 bits (806), Expect = e-105
 Identities = 141/177 (79%), Positives = 155/177 (87%), Gaps = 3/177 (1%)

Query: 24  SEKAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVI 83
           +EK  STLSIT VGASGDLAKKKIFPALFAL+YED LPE+FTVFGYARTKLTDEELR++I
Sbjct: 82  AEKGESTLSITVVGASGDLAKKKIFPALFALFYEDWLPENFTVFGYARTKLTDEELRDMI 141

Query: 84  RKTLTCGIDKKYT---KLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYL 140
             TLTC ID++     K+DQFLKRCFYHSG Y+SEE FAEL+ KLKEKE GKLSNRLFYL
Sbjct: 142 SSTLTCRIDQRENCGDKMDQFLKRCFYHSGQYDSEEDFAELNKKLKEKEAGKLSNRLFYL 201

Query: 141 SIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF 197
           SIPPNIFV+V +CASLRASS  GWTRVIVEKP GRDS+SSGELTR LKQYL E+QIF
Sbjct: 202 SIPPNIFVDVVRCASLRASSENGWTRVIVEKPFGRDSESSGELTRCLKQYLTEEQIF 258

Length = 573
>gnl|CDD|215191 PLN02333, PLN02333, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|215937 pfam00479, G6PD_N, Glucose-6-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|235579 PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240353 PTZ00309, PTZ00309, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223441 COG0364, Zwf, Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233162 TIGR00871, zwf, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|178154 PLN02539, PLN02539, glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>gnl|CDD|237233 PRK12853, PRK12853, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237234 PRK12854, PRK12854, glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
PF00479183 G6PD_N: Glucose-6-phosphate dehydrogenase, NAD bin 100.0
PLN02333 604 glucose-6-phosphate 1-dehydrogenase 100.0
PLN02640 573 glucose-6-phosphate 1-dehydrogenase 100.0
PRK05722 495 glucose-6-phosphate 1-dehydrogenase; Validated 100.0
PLN02539 491 glucose-6-phosphate 1-dehydrogenase 100.0
COG0364 483 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydr 100.0
PTZ00309 542 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
PRK12853 482 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
TIGR00871 482 zwf glucose-6-phosphate 1-dehydrogenase. This is a 100.0
PRK12854 484 glucose-6-phosphate 1-dehydrogenase; Provisional 100.0
KOG0563 499 consensus Glucose-6-phosphate 1-dehydrogenase [Car 100.0
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.76
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.79
PRK10206 344 putative oxidoreductase; Provisional 96.73
COG0673 342 MviM Predicted dehydrogenases and related proteins 96.67
PRK11579 346 putative oxidoreductase; Provisional 96.47
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.62
PRK07326237 short chain dehydrogenase; Provisional 94.33
PRK07454241 short chain dehydrogenase; Provisional 94.27
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 94.2
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 93.62
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 93.61
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 93.43
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 93.3
PLN02896 353 cinnamyl-alcohol dehydrogenase 93.07
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.06
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.86
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.25
PRK06124 256 gluconate 5-dehydrogenase; Provisional 92.22
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.15
PRK07774 250 short chain dehydrogenase; Provisional 91.76
PRK08251 248 short chain dehydrogenase; Provisional 91.65
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 91.61
PRK09186 256 flagellin modification protein A; Provisional 91.31
PRK07478 254 short chain dehydrogenase; Provisional 91.25
PRK07677 252 short chain dehydrogenase; Provisional 90.91
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.68
PRK08643 256 acetoin reductase; Validated 90.66
PRK08213 259 gluconate 5-dehydrogenase; Provisional 90.59
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 90.56
PRK06172 253 short chain dehydrogenase; Provisional 90.5
PRK05866 293 short chain dehydrogenase; Provisional 90.37
PRK12827249 short chain dehydrogenase; Provisional 90.11
PRK07806248 short chain dehydrogenase; Provisional 90.08
PRK07062 265 short chain dehydrogenase; Provisional 90.07
PRK08628 258 short chain dehydrogenase; Provisional 90.03
PRK07523 255 gluconate 5-dehydrogenase; Provisional 89.99
PRK07775 274 short chain dehydrogenase; Provisional 89.96
PRK06914 280 short chain dehydrogenase; Provisional 89.92
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 89.87
PRK07102243 short chain dehydrogenase; Provisional 89.78
PRK10538 248 malonic semialdehyde reductase; Provisional 89.64
PRK12828239 short chain dehydrogenase; Provisional 89.57
PRK06125 259 short chain dehydrogenase; Provisional 89.45
PRK08265 261 short chain dehydrogenase; Provisional 89.45
PRK07074 257 short chain dehydrogenase; Provisional 89.38
PRK12937245 short chain dehydrogenase; Provisional 89.32
PRK07832 272 short chain dehydrogenase; Provisional 89.25
PRK06182 273 short chain dehydrogenase; Validated 89.17
PRK07814 263 short chain dehydrogenase; Provisional 89.14
PRK07825 273 short chain dehydrogenase; Provisional 89.07
PRK12939 250 short chain dehydrogenase; Provisional 88.99
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 88.97
PRK12743 256 oxidoreductase; Provisional 88.91
PRK08226 263 short chain dehydrogenase; Provisional 88.83
PRK07109 334 short chain dehydrogenase; Provisional 88.81
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 88.74
PRK09135249 pteridine reductase; Provisional 88.71
PRK06701 290 short chain dehydrogenase; Provisional 88.7
PRK06500 249 short chain dehydrogenase; Provisional 88.6
PRK06181 263 short chain dehydrogenase; Provisional 88.58
PRK07890 258 short chain dehydrogenase; Provisional 88.47
PRK09072 263 short chain dehydrogenase; Provisional 88.45
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 88.33
PRK06196 315 oxidoreductase; Provisional 88.29
PRK05650 270 short chain dehydrogenase; Provisional 88.26
PRK05875 276 short chain dehydrogenase; Provisional 88.22
CHL00194 317 ycf39 Ycf39; Provisional 88.16
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 88.1
PRK08278 273 short chain dehydrogenase; Provisional 88.08
PRK12744 257 short chain dehydrogenase; Provisional 88.0
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 88.0
PRK06138 252 short chain dehydrogenase; Provisional 87.93
PRK08263 275 short chain dehydrogenase; Provisional 87.8
PRK08177225 short chain dehydrogenase; Provisional 87.77
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 87.74
PRK05993 277 short chain dehydrogenase; Provisional 87.53
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 87.47
PRK05717 255 oxidoreductase; Validated 87.47
PRK06198 260 short chain dehydrogenase; Provisional 87.45
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 87.37
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 87.32
PRK08264238 short chain dehydrogenase; Validated 87.25
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.15
PRK07904253 short chain dehydrogenase; Provisional 87.03
PRK12829 264 short chain dehydrogenase; Provisional 86.97
PRK09242 257 tropinone reductase; Provisional 86.84
PRK07024 257 short chain dehydrogenase; Provisional 86.77
PRK08277 278 D-mannonate oxidoreductase; Provisional 86.72
PRK06482 276 short chain dehydrogenase; Provisional 86.7
TIGR02415 254 23BDH acetoin reductases. One member of this famil 86.69
PRK07067 257 sorbitol dehydrogenase; Provisional 86.65
PRK06949 258 short chain dehydrogenase; Provisional 86.62
PRK05693 274 short chain dehydrogenase; Provisional 86.57
PRK06523 260 short chain dehydrogenase; Provisional 86.55
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 86.34
PRK07069 251 short chain dehydrogenase; Validated 85.95
PLN02583 297 cinnamoyl-CoA reductase 85.94
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 85.58
PRK12824 245 acetoacetyl-CoA reductase; Provisional 85.3
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 85.18
PRK07097 265 gluconate 5-dehydrogenase; Provisional 85.16
COG0300 265 DltE Short-chain dehydrogenases of various substra 85.02
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 84.98
PRK06057 255 short chain dehydrogenase; Provisional 84.77
PRK08589 272 short chain dehydrogenase; Validated 84.71
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 84.7
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 84.69
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 84.69
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 84.56
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 84.5
PRK07035 252 short chain dehydrogenase; Provisional 84.46
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.3
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 84.17
PRK06197 306 short chain dehydrogenase; Provisional 83.88
PRK06953222 short chain dehydrogenase; Provisional 83.81
PRK08085 254 gluconate 5-dehydrogenase; Provisional 83.69
PRK06180 277 short chain dehydrogenase; Provisional 83.49
PRK07063 260 short chain dehydrogenase; Provisional 83.24
PRK08219227 short chain dehydrogenase; Provisional 82.97
PLN02427 386 UDP-apiose/xylose synthase 82.88
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 82.82
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 82.81
PRK06114 254 short chain dehydrogenase; Provisional 82.78
PRK05854 313 short chain dehydrogenase; Provisional 82.7
PRK06179 270 short chain dehydrogenase; Provisional 82.62
PRK08340 259 glucose-1-dehydrogenase; Provisional 82.33
PRK05855 582 short chain dehydrogenase; Validated 82.31
PRK06139 330 short chain dehydrogenase; Provisional 82.27
PRK06924 251 short chain dehydrogenase; Provisional 82.25
PRK05867 253 short chain dehydrogenase; Provisional 82.14
PRK09291257 short chain dehydrogenase; Provisional 81.99
PRK06101240 short chain dehydrogenase; Provisional 81.92
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 81.75
PRK07831262 short chain dehydrogenase; Provisional 81.71
PLN02240 352 UDP-glucose 4-epimerase 81.67
PRK06194 287 hypothetical protein; Provisional 81.65
PRK06398 258 aldose dehydrogenase; Validated 81.2
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 81.09
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 81.06
PRK06947 248 glucose-1-dehydrogenase; Provisional 80.96
PRK07576 264 short chain dehydrogenase; Provisional 80.74
PRK07023 243 short chain dehydrogenase; Provisional 80.6
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 80.58
smart00822180 PKS_KR This enzymatic domain is part of bacterial 80.28
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 80.02
PRK08267 260 short chain dehydrogenase; Provisional 80.01
>PF00479 G6PD_N: Glucose-6-phosphate dehydrogenase, NAD binding domain; InterPro: IPR022674 Glucose-6-phosphate dehydrogenase (1 Back     alignment and domain information 
Probab=100.00  E-value=9.5e-62  Score=401.43  Aligned_cols=164  Identities=43%  Similarity=0.778  Sum_probs=141.5

Q ss_pred             EEEcccchhchhhhHHHHHHHHHcCCCCCCcEEEEEeCCCCChHHHHHHHHHHhhcc--CCCchhHHHHHHhcCceeeec
Q 038626           34 TFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCG--IDKKYTKLDQFLKRCFYHSGL  111 (197)
Q Consensus        34 VIFGAtGDLA~RKL~PAL~~L~~~g~lp~~~~IiG~aR~~~s~e~fr~~v~~~l~~~--~~~~~~~~~~F~~~~~Y~~~d  111 (197)
                      ||||||||||+|||+||||+|+++|+||++++|||+||++||+++|++++++++.+.  ...+++.|++|+++++|+++|
T Consensus         1 VifGatGDLA~RKL~PaL~~L~~~g~lp~~~~Iig~~R~~~~~~~f~~~v~~~l~~~~~~~~~~~~~~~F~~~~~Y~~~d   80 (183)
T PF00479_consen    1 VIFGATGDLAKRKLLPALYNLYRDGLLPEDFRIIGVARSDLSDEEFREKVREALKKFSREEIDEEKWEEFLSRLHYVQGD   80 (183)
T ss_dssp             EEETTTSHHHHHTHHHHHHHHHHTTSS-SSEEEEEEESS--SHHCCHHHHHHCCGG-S-CCCSHHHHHHHHTTEEEEE--
T ss_pred             CEeccccHHHHhHHHHHHHHHHHhCCCCCCcEEEEecCCcCCHHHHHHHHHHHHHhhhccccCHHHHHHHhhccEEEeCC
Confidence            899999999999999999999999999999999999999999999999999999872  223678999999999999999


Q ss_pred             CCCHhhHHHHHHHHhhhh--cCCccceEEEecCCcccHHHHHHHHHhhcCCC--CCCeEEEEecCCCCChhhHHHHHHHH
Q 038626          112 YNSEEHFAELDSKLKEKE--VGKLSNRLFYLSIPPNIFVEVAKCASLRASSA--TGWTRVIVEKPIGRDSKSSGELTRSL  187 (197)
Q Consensus       112 ~~~~~~y~~L~~~l~~~~--~~~~~~rlfYLAvPP~~f~~i~~~l~~~~~~~--~~~~RIViEKPFG~DL~SA~~LN~~L  187 (197)
                      ++++++|.+|++.|.+.+  .+...||+|||||||++|.+||++|+.+|+..  .+|+|||||||||+||+||++||+.|
T Consensus        81 ~~~~~~y~~L~~~l~~~~~~~~~~~~rifYLAvPP~~f~~i~~~L~~~~l~~~~~g~~RiVvEKPFG~Dl~SA~~Ln~~l  160 (183)
T PF00479_consen   81 YDDPESYAALKKALEELENKYGTEANRIFYLAVPPSLFGPIARNLSEAGLNEEPNGWSRIVVEKPFGRDLESARELNDQL  160 (183)
T ss_dssp             SS-HHHHHHHHHHHHHHHHCTTTTSEEEEEE-S-GGGHHHHHHHHHHHT-S-TSSS-EEEEESSTSTSSHHHHHHHHHHH
T ss_pred             CCCchhHHHHHHHHHHhhhhcCCCcceEEEeccCHHHHHHHHHHHHHHhcccccCCceEEEEeCCCCCCHHHHHHHHHHH
Confidence            999999999999998754  24668999999999999999999999998653  37999999999999999999999999


Q ss_pred             hhhCCCCCCC
Q 038626          188 KQYLREDQIF  197 (197)
Q Consensus       188 ~~~F~E~qIy  197 (197)
                      +++|+|+|||
T Consensus       161 ~~~f~E~qIy  170 (183)
T PF00479_consen  161 AEYFDEEQIY  170 (183)
T ss_dssp             CTTS-GGGEE
T ss_pred             HHhCCHHHee
Confidence            9999999998

1.1.49 from EC) (G6PDH) is a ubiquitous protein, present in bacteria and all eukaryotic cell types []. The enzyme catalyses the the first step in the pentose pathway, i.e. the conversion of glucose-6-phosphate to gluconolactone 6-phosphate in the presence of NADP, producing NADPH. The ubiquitous expression of the enzyme gives it a major role in the production of NADPH for the many NADPH-mediated reductive processes in all cells []. Deficiency of G6PDH is a common genetic abnormality affecting millions of people worldwide. Many sequence variants, most caused by single point mutations, are known, exhibiting a wide variety of phenotypes []. This entry represents the NAD-binding domain of glucose-6-phosphate dehydrogenase.; GO: 0004345 glucose-6-phosphate dehydrogenase activity, 0050661 NADP binding, 0006006 glucose metabolic process, 0055114 oxidation-reduction process; PDB: 4EM5_C 4E9I_A 2DPG_A 1E77_A 1E7M_A 1H9B_A 1E7Y_A 1DPG_B 1H93_A 1H9A_A ....
>PLN02333 glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>PLN02640 glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>PRK05722 glucose-6-phosphate 1-dehydrogenase; Validated Back     alignment and domain information
>PLN02539 glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>COG0364 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00309 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12853 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00871 zwf glucose-6-phosphate 1-dehydrogenase Back     alignment and domain information
>PRK12854 glucose-6-phosphate 1-dehydrogenase; Provisional Back     alignment and domain information
>KOG0563 consensus Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
4e9i_A 541 Glucose-6-P Dehydrogenase (Apo Form) From Trypanoso 6e-32
2bh9_A 489 X-Ray Structure Of A Deletion Variant Of Human Gluc 4e-30
1qki_A 514 X-Ray Structure Of Human Glucose 6-Phosphate Dehydr 5e-30
1e7m_A 485 Active Site Mutant (D177->n) Of Glucose 6-Phosphate 2e-19
2dpg_A 485 Complex Of Inactive Mutant (H240->n) Of Glucose 6-P 2e-19
1h93_A 485 Active Mutant (S215->c) Of Glucose 6-Phosphate Dehy 3e-19
1e77_A 485 Complex Of Active Mutant (Q365->c) Of Glucose 6-Pho 3e-19
1dpg_A 485 Glucose 6-Phosphate Dehydrogenase From Leuconostoc 5e-19
>pdb|4E9I|A Chain A, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma Cruzi Length = 541 Back     alignment and structure 
Iteration: 1

 Score =  133 bits (335), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 104/184 (56%), Gaps = 8/184 (4%)
Query: 22  ASSEKAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTD-EELR 80
            S E     L+I  +GASGDLAKKK FPALF LY    LP D  + GYAR+ + D E+ +
Sbjct: 46  VSPELRSRALTIVVLGASGDLAKKKTFPALFQLYCNGMLPRDVNILGYARSTMEDVEKWK 105
Query: 81  NVIRKTLTCGIDKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVG-----KLSN 135
                     +D++   +  FL+R  Y +G Y+ +E FA L+ ++   E       K  N
Sbjct: 106 KDTLAGFFTRLDERGCHVGNFLRRISYMTGSYDRDEDFARLNERILRMEEAFQGPEKGGN 165
Query: 136 RLFYLSIPPNIFVEVAKCASLRASSAT--GWTRVIVEKPIGRDSKSSGELTRSLKQYLRE 193
           RLFYL++PP++FV V +  S  A      GW R+IVEKP GRD+++S +L+  LK    E
Sbjct: 166 RLFYLALPPSVFVGVCRGLSKGAMQKPELGWVRLIVEKPFGRDTETSEQLSNQLKPLFNE 225
Query: 194 DQIF 197
            Q+F
Sbjct: 226 RQVF 229
>pdb|2BH9|A Chain A, X-Ray Structure Of A Deletion Variant Of Human Glucose 6- Phosphate Dehydrogenase Complexed With Structural And Coenzyme Nadp Length = 489 Back     alignment and structure
>pdb|1QKI|A Chain A, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase (Variant Canton R459l) Complexed With Structural Nadp+ Length = 514 Back     alignment and structure
>pdb|1E7M|A Chain A, Active Site Mutant (D177->n) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure
>pdb|2DPG|A Chain A, Complex Of Inactive Mutant (H240->n) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides With Nadp+ Length = 485 Back     alignment and structure
>pdb|1H93|A Chain A, Active Mutant (S215->c) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure
>pdb|1E77|A Chain A, Complex Of Active Mutant (Q365->c) Of Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides With Substrate Length = 485 Back     alignment and structure
>pdb|1DPG|A Chain A, Glucose 6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides Length = 485 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2bh9_A 489 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidore 4e-71
4e9i_A 541 Glucose-6-phosphate 1-dehydrogenase; pentose phosp 6e-67
1dpg_A 485 G6PD, glucose 6-phosphate dehydrogenase; oxidoredu 4e-63
>2bh9_A G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Length = 489 Back     alignment and structure
 Score =  222 bits (568), Expect = 4e-71
 Identities = 64/165 (38%), Positives = 95/165 (57%), Gaps = 1/165 (0%)

Query: 33  ITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGID 92
              +GASGDLAKKKI+P ++ L+ +  LPE+  + GYAR++LT  ++R           +
Sbjct: 8   FIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPE 67

Query: 93  KKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAK 152
           +K  KL+ F  R  Y +G Y+    +  L+S +    +G  +NRLFYL++PP ++  V K
Sbjct: 68  EK-LKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVTK 126

Query: 153 CASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF 197
                  S  GW R+IVEKP GRD +SS  L+  +    REDQI+
Sbjct: 127 NIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIY 171
>4e9i_A Glucose-6-phosphate 1-dehydrogenase; pentose phosphate pathway, alpha beta, NAD(P) rossmann-like domain, oxidoreductase; 2.85A {Trypanosoma cruzi} PDB: 4em5_A* Length = 541 Back     alignment and structure
>1dpg_A G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} SCOP: c.2.1.3 d.81.1.5 PDB: 1e7y_A* 1e7m_A* 1h93_A 1h94_A* 1h9a_A* 1e77_A* 1h9b_A 2dpg_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
2bh9_A 489 G6PD, glucose-6-phosphate 1-dehydrogenase; oxidore 100.0
1dpg_A 485 G6PD, glucose 6-phosphate dehydrogenase; oxidoredu 100.0
4e9i_A 541 Glucose-6-phosphate 1-dehydrogenase; pentose phosp 100.0
4had_A 350 Probable oxidoreductase protein; structural genomi 97.4
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 97.28
4h3v_A 390 Oxidoreductase domain protein; structural genomics 97.2
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.15
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 97.14
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.99
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 96.95
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 96.93
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.88
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.87
1ydw_A 362 AX110P-like protein; structural genomics, protein 96.87
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.85
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.81
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.79
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.77
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 96.7
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.7
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.69
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 96.69
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.67
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.64
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.63
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.63
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 96.58
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 96.57
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 96.54
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 96.54
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.51
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 96.48
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.48
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 96.48
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 96.44
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 96.38
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.11
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.07
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 96.07
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 95.84
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.45
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.81
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.8
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 94.45
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 94.37
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 94.37
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.29
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 94.12
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 93.92
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 93.75
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.73
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 93.57
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 93.44
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 93.35
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.06
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 92.83
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 92.82
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 92.34
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 92.34
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 92.21
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 91.99
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 91.54
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 91.43
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 91.32
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 91.21
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 91.12
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 91.08
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 91.04
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 90.92
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 90.8
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 90.55
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 90.45
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 90.41
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 90.11
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 90.1
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 90.1
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 90.06
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 90.05
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 89.97
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 89.82
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 89.81
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 89.75
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 89.71
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 89.69
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 89.68
1xq6_A 253 Unknown protein; structural genomics, protein stru 89.66
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 89.65
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 89.49
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 89.48
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 89.45
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 89.24
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 89.17
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 89.01
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 89.01
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 88.98
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 88.86
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 88.69
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 88.67
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 88.66
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 88.65
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 88.57
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 88.57
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 88.49
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 88.45
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 88.23
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 88.23
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 88.17
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 88.11
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 88.07
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 88.04
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 88.02
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 87.95
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 87.79
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 87.78
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 87.74
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 87.59
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 87.51
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 87.39
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 87.38
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 87.18
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 86.9
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 86.84
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 86.75
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 86.71
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 86.56
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 86.36
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 86.34
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 86.33
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 86.32
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 86.28
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 86.24
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 86.17
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 86.05
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 85.86
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 85.8
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 85.78
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 85.78
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 85.77
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 85.7
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 85.64
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 85.6
4f6l_B 508 AUSA reductase domain protein; thioester reductase 85.56
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 85.52
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 85.48
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 85.48
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 85.47
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 85.29
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 85.19
4f6c_A 427 AUSA reductase domain protein; thioester reductase 85.15
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 84.87
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 84.63
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 84.59
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 84.43
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 84.27
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 84.25
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 84.22
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 84.21
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 84.14
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 84.04
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 84.01
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 83.97
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 83.87
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 83.72
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 83.7
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 83.48
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 83.42
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 83.31
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 83.3
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 83.28
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 83.28
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 83.23
3cxt_A 291 Dehydrogenase with different specificities; rossma 83.22
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 83.16
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 83.12
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 83.05
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 83.05
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 82.92
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 82.83
1xq1_A 266 Putative tropinone reducatse; structural genomics, 82.68
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 82.56
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 82.45
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 82.3
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 82.29
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 82.27
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 82.27
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 82.15
3rih_A 293 Short chain dehydrogenase or reductase; structural 81.96
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 81.87
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 81.85
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 81.81
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 81.75
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 81.66
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 81.65
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 81.12
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 81.0
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 80.86
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 80.76
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 80.75
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 80.66
3imf_A 257 Short chain dehydrogenase; structural genomics, in 80.59
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 80.44
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 80.43
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 80.12
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 80.08
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 80.04
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 80.03
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 80.02
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 80.01
>2bh9_A G6PD, glucose-6-phosphate 1-dehydrogenase; oxidoreductase, oxidoreductase (CHOH(D)-NADP), carbohydrate metabolism, glucose metabolism; HET: NAP; 2.5A {Homo sapiens} PDB: 2bhl_A* 1qki_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-57  Score=417.74  Aligned_cols=168  Identities=38%  Similarity=0.696  Sum_probs=155.8

Q ss_pred             CCeEEEEEcccchhchhhhHHHHHHHHHcCCCCCCcEEEEEeCCCCChHHHHHHHHHHhhccCCCchhHHHHHHhcCcee
Q 038626           29 STLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRCFYH  108 (197)
Q Consensus        29 ~~~~lVIFGAtGDLA~RKL~PAL~~L~~~g~lp~~~~IiG~aR~~~s~e~fr~~v~~~l~~~~~~~~~~~~~F~~~~~Y~  108 (197)
                      ++|+|||||||||||+|||+||||+|+++|+||++++|||+||++||+++||+++++++++.. .+++.|++|+++++|+
T Consensus         4 ~~~~~VIFGatGDLA~RKL~PaLy~L~~~g~Lp~~~~iiG~aR~~~~~~~~r~~~~~~l~~~~-~~~~~~~~F~~~~~Y~   82 (489)
T 2bh9_A            4 DTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATP-EEKLKLEDFFARNSYV   82 (489)
T ss_dssp             CCEEEEEETTTSHHHHHTHHHHHHHHHHTTCSCSSEEEEEEESSCCCHHHHHHHHGGGSCCCG-GGHHHHHHHHHTEEEE
T ss_pred             CCeEEEEeCCcHHHHHHhHHHHHHHHHHcCCCCCCcEEEEEeCCCCCHHHHHHHHHHHHhccc-CCHHHHHHHHhcCEEE
Confidence            479999999999999999999999999999999999999999999999999999999997632 2457899999999999


Q ss_pred             eecCCCHhhHHHHHHHHhhhhcCCccceEEEecCCcccHHHHHHHHHhhcCCCCCCeEEEEecCCCCChhhHHHHHHHHh
Q 038626          109 SGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLK  188 (197)
Q Consensus       109 ~~d~~~~~~y~~L~~~l~~~~~~~~~~rlfYLAvPP~~f~~i~~~l~~~~~~~~~~~RIViEKPFG~DL~SA~~LN~~L~  188 (197)
                      ++|++++++|.+|++.|.+.+.+...||+|||||||++|++||++|+.+|+...+|+|||||||||+||+||++||+.|+
T Consensus        83 ~~d~~~~~~~~~L~~~l~~~~~~~~~nr~fYLA~pP~~f~~i~~~L~~~gl~~~g~~RvViEKPFG~DL~SA~~Ln~~l~  162 (489)
T 2bh9_A           83 AGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHIS  162 (489)
T ss_dssp             ECCSSCHHHHHHHHHHHHTTTTTTTSEEEEEECSCTTSHHHHHHHHHHHSCCSSSCEEEEECSCSCSSHHHHHHHHHHHT
T ss_pred             ecCCCCHHHHHHHHHHHHHhhccCCCceEEEEeCCHHHHHHHHHHHHHhCCCcCCceEEEEeCCCCCchhhHHHHHHHHH
Confidence            99999999999999999865534446999999999999999999999999755579999999999999999999999999


Q ss_pred             hhCCCCCCC
Q 038626          189 QYLREDQIF  197 (197)
Q Consensus       189 ~~F~E~qIy  197 (197)
                      ++|+|+|||
T Consensus       163 ~~F~E~qIy  171 (489)
T 2bh9_A          163 SLFREDQIY  171 (489)
T ss_dssp             TTSCGGGEE
T ss_pred             hhCCHHHee
Confidence            999999998
>1dpg_A G6PD, glucose 6-phosphate dehydrogenase; oxidoreductase, NADP/NAD, glucose metabolism, oxidoreductase (CHOH(D) - NAD(P)); 2.00A {Leuconostoc mesenteroides} SCOP: c.2.1.3 d.81.1.5 PDB: 1e7y_A* 1e7m_A* 1h93_A 1h94_A* 1h9a_A* 1e77_A* 1h9b_A 2dpg_A* Back     alignment and structure
>4e9i_A Glucose-6-phosphate 1-dehydrogenase; pentose phosphate pathway, alpha beta, NAD(P) rossmann-like domain, oxidoreductase; 2.85A {Trypanosoma cruzi} PDB: 4em5_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1qkia1203 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate d 2e-50
d1h9aa1195 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate de 6e-45
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glucose 6-phosphate dehydrogenase, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  160 bits (405), Expect = 2e-50
 Identities = 65/166 (39%), Positives = 96/166 (57%), Gaps = 3/166 (1%)

Query: 34  TFV--GASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGI 91
            F+  GASGDLAKKKI+P ++ L+ +  LPE+  + GYAR++LT  ++R           
Sbjct: 22  IFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATP 81

Query: 92  DKKYTKLDQFLKRCFYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVA 151
           ++K  KL+ F  R  Y +G Y+    +  L+S +    +G  +NRLFYL++PP ++  V 
Sbjct: 82  EEK-LKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVT 140

Query: 152 KCASLRASSATGWTRVIVEKPIGRDSKSSGELTRSLKQYLREDQIF 197
           K       S  GW R+IVEKP GRD +SS  L+  +    REDQI+
Sbjct: 141 KNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIY 186
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1qkia1203 Glucose 6-phosphate dehydrogenase, N-terminal doma 100.0
d1h9aa1195 Glucose 6-phosphate dehydrogenase, N-terminal doma 100.0
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 97.91
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.8
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.44
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.27
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.62
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 95.9
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.14
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.5
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 91.22
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 89.81
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 89.66
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 89.31
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.46
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 87.14
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 86.04
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 84.59
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.57
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 83.07
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 81.24
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glucose 6-phosphate dehydrogenase, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3e-62  Score=407.21  Aligned_cols=171  Identities=37%  Similarity=0.686  Sum_probs=157.1

Q ss_pred             cCCCCeEEEEEcccchhchhhhHHHHHHHHHcCCCCCCcEEEEEeCCCCChHHHHHHHHHHhhccCCCchhHHHHHHhcC
Q 038626           26 KAGSTLSITFVGASGDLAKKKIFPALFALYYEDCLPEDFTVFGYARTKLTDEELRNVIRKTLTCGIDKKYTKLDQFLKRC  105 (197)
Q Consensus        26 ~~~~~~~lVIFGAtGDLA~RKL~PAL~~L~~~g~lp~~~~IiG~aR~~~s~e~fr~~v~~~l~~~~~~~~~~~~~F~~~~  105 (197)
                      +..+|++|||||||||||+|||+||||+|+++|+||++++|||+||+++++++|++.+++.+.... .++..|++|++++
T Consensus        16 ~~~~~~t~VIFGatGDLA~RKL~PALf~L~~~g~Lp~~~~Iig~aR~~~s~e~fr~~~~~~~~~~~-~~~~~~~~f~~~~   94 (203)
T d1qkia1          16 HQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATP-EEKLKLEDFFARN   94 (203)
T ss_dssp             CCSCCEEEEEETTTSHHHHHTHHHHHHHHHHTTCSCSSEEEEEEBSSCCSCHHHHHHHSCCTTCCG-GGHHHHHHHHTTE
T ss_pred             CCCCCcEEEEECcccHHHHhHHHHHHHHHHHcCCCCCCcEEEEEECCCCCHHHHHHHHHHHHhhch-hhHHHHHHHHHhh
Confidence            345699999999999999999999999999999999999999999999999999999887776432 2456799999999


Q ss_pred             ceeeecCCCHhhHHHHHHHHhhhhcCCccceEEEecCCcccHHHHHHHHHhhcCCCCCCeEEEEecCCCCChhhHHHHHH
Q 038626          106 FYHSGLYNSEEHFAELDSKLKEKEVGKLSNRLFYLSIPPNIFVEVAKCASLRASSATGWTRVIVEKPIGRDSKSSGELTR  185 (197)
Q Consensus       106 ~Y~~~d~~~~~~y~~L~~~l~~~~~~~~~~rlfYLAvPP~~f~~i~~~l~~~~~~~~~~~RIViEKPFG~DL~SA~~LN~  185 (197)
                      +|+++|++++++|.+|++.+.+.+.+...+|+|||||||++|++||++|+.+|...++|+|||||||||+|++||++||+
T Consensus        95 ~Y~~~d~~~~~~~~~L~~~l~~~~~~~~~~rifYLAvpP~~f~~i~~~L~~~~l~~~~~~RiVvEKPfG~Dl~SA~~Ln~  174 (203)
T d1qkia1          95 SYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSN  174 (203)
T ss_dssp             ECCBCCTTCHHHHHHHHHHHHHTTTTTTSEEEEEECSCHHHHHHHHHHHHHHSCCSSSCEEEEESCCCCSCHHHHHHHHH
T ss_pred             ccccCcCCChhhHHHHHHHHHHHhcCCCcceEEEEecCHHHHHHHHHHHHHhcCCccCceeEEEecCCCCChHHHHHHHH
Confidence            99999999999999999999876555567999999999999999999999998766689999999999999999999999


Q ss_pred             HHhhhCCCCCCC
Q 038626          186 SLKQYLREDQIF  197 (197)
Q Consensus       186 ~L~~~F~E~qIy  197 (197)
                      .|+++|+|+|||
T Consensus       175 ~l~~~f~E~qIy  186 (203)
T d1qkia1         175 HISSLFREDQIY  186 (203)
T ss_dssp             HHHHHSCGGGEE
T ss_pred             HHHhhCCHHHcc
Confidence            999999999998
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure