Citrus Sinensis ID: 038655
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| 255577068 | 274 | carbonic anhydrase, putative [Ricinus co | 0.996 | 1.0 | 0.718 | 1e-113 | |
| 359478710 | 274 | PREDICTED: bifunctional monodehydroascor | 0.996 | 1.0 | 0.675 | 1e-111 | |
| 224132524 | 240 | predicted protein [Populus trichocarpa] | 0.872 | 1.0 | 0.754 | 1e-108 | |
| 224106798 | 240 | predicted protein [Populus trichocarpa] | 0.872 | 1.0 | 0.733 | 1e-106 | |
| 255577070 | 272 | carbonic anhydrase, putative [Ricinus co | 0.894 | 0.904 | 0.712 | 1e-106 | |
| 356547165 | 274 | PREDICTED: bifunctional monodehydroascor | 0.956 | 0.959 | 0.657 | 1e-103 | |
| 356541924 | 255 | PREDICTED: LOW QUALITY PROTEIN: bifuncti | 0.927 | 1.0 | 0.628 | 1e-94 | |
| 297849106 | 275 | carbonic anhydrase family protein [Arabi | 0.876 | 0.876 | 0.655 | 1e-93 | |
| 15223122 | 275 | carbonic anhydrase [Arabidopsis thaliana | 0.876 | 0.876 | 0.651 | 3e-93 | |
| 449499777 | 275 | PREDICTED: bifunctional monodehydroascor | 0.956 | 0.956 | 0.598 | 6e-93 |
| >gi|255577068|ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus communis] gi|223531095|gb|EEF32944.1| carbonic anhydrase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 412 bits (1059), Expect = e-113, Method: Compositional matrix adjust.
Identities = 197/274 (71%), Positives = 236/274 (86%)
Query: 1 MEKLATELLFYRFFAVILLLSGSAMSKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKN 60
M KLA ++LF FF LL + S+EV+ E+EF+YEK GE GP RWGE+H EW AC N
Sbjct: 1 MGKLAIQILFLTFFFAFLLHTLPTTSQEVENEREFDYEKNGERGPARWGELHEEWRACSN 60
Query: 61 GTMQSPIDLLNERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYV 120
G+MQSPID+LNERVEVVSHLGRL RSY+PSNATL+NRGHD+ML+W+ GAGTI INGT+Y+
Sbjct: 61 GSMQSPIDMLNERVEVVSHLGRLNRSYEPSNATLKNRGHDMMLEWENGAGTIEINGTEYI 120
Query: 121 LQQCHWHSPSEHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGRPDSFLASISDHLRNI 180
L+QCHWHSPSEHT+DG+RFALE HMVHES DGKVAVVG++Y IGRPDSFL S++DHLR+I
Sbjct: 121 LRQCHWHSPSEHTLDGRRFALELHMVHESPDGKVAVVGVMYTIGRPDSFLLSLTDHLRSI 180
Query: 181 SGSNERDATVGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVL 240
SG+ E + VG+I+P+ IKIGS KYYRY+GSLTVPPCTENV WTIV+KVR+VTREQV +L
Sbjct: 181 SGTEEEERVVGIINPKDIKIGSRKYYRYMGSLTVPPCTENVIWTIVKKVRTVTREQVSLL 240
Query: 241 RVAVHDESNTNARPLQPINMRSVKLYKPDEENEN 274
RVAVHDES+TNARPLQ IN RSV LY+P+E N++
Sbjct: 241 RVAVHDESDTNARPLQQINGRSVHLYRPEENNDD 274
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359478710|ref|XP_002282495.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Vitis vinifera] gi|297746283|emb|CBI16339.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224132524|ref|XP_002328312.1| predicted protein [Populus trichocarpa] gi|222837827|gb|EEE76192.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224106798|ref|XP_002314288.1| predicted protein [Populus trichocarpa] gi|222850696|gb|EEE88243.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255577070|ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus communis] gi|223531096|gb|EEF32945.1| carbonic anhydrase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356547165|ref|XP_003541987.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356541924|ref|XP_003539422.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297849106|ref|XP_002892434.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338276|gb|EFH68693.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15223122|ref|NP_172287.1| carbonic anhydrase [Arabidopsis thaliana] gi|21689637|gb|AAM67440.1| putative storage protein [Arabidopsis thaliana] gi|332190119|gb|AEE28240.1| carbonic anhydrase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449499777|ref|XP_004160914.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| TAIR|locus:2205175 | 275 | ACA7 "alpha carbonic anhydrase | 0.938 | 0.938 | 0.616 | 1.7e-89 | |
| TAIR|locus:2827099 | 277 | ACA5 "alpha carbonic anhydrase | 0.945 | 0.938 | 0.538 | 9.3e-75 | |
| UNIPROTKB|Q84UV8 | 274 | NEC3 "Bifunctional monodehydro | 0.916 | 0.919 | 0.536 | 3e-69 | |
| TAIR|locus:2062819 | 217 | ACA2 "alpha carbonic anhydrase | 0.752 | 0.953 | 0.591 | 3.1e-67 | |
| TAIR|locus:2133119 | 267 | ACA4 "alpha carbonic anhydrase | 0.963 | 0.992 | 0.470 | 1.2e-65 | |
| TAIR|locus:2161043 | 350 | ACA8 "alpha carbonic anhydrase | 0.629 | 0.494 | 0.491 | 2.3e-56 | |
| TAIR|locus:2133129 | 260 | ACA6 "alpha carbonic anhydrase | 0.792 | 0.838 | 0.466 | 1.1e-55 | |
| TAIR|locus:2146723 | 277 | ACA3 "alpha carbonic anhydrase | 0.909 | 0.902 | 0.434 | 1.4e-55 | |
| TAIR|locus:2083213 | 284 | ACA1 "alpha carbonic anhydrase | 0.923 | 0.894 | 0.391 | 1.1e-48 | |
| UNIPROTKB|Q9KMP6 | 239 | VC_A0274 "Carbonic anhydrase" | 0.810 | 0.933 | 0.359 | 1.8e-30 |
| TAIR|locus:2205175 ACA7 "alpha carbonic anhydrase 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 893 (319.4 bits), Expect = 1.7e-89, P = 1.7e-89
Identities = 159/258 (61%), Positives = 203/258 (78%)
Query: 11 YRFFAVILLLSGSAMSKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLL 70
+ F ++ + S ++ EV++E+EFNY+K E GP+RWGE+ EW C G MQSPIDL+
Sbjct: 16 FSIFTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGKGEMQSPIDLM 75
Query: 71 NERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPS 130
NERV +VSHLGRL R Y PSNATL+NRGHDIML+++ GAGTI ING +Y LQQ HWHSPS
Sbjct: 76 NERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFEDGAGTIKINGFEYELQQLHWHSPS 135
Query: 131 EHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDATV 190
EHTI+G+RFALE HMVHE + ++AVV ++YKIGR D+F+ S+ L I+ E + V
Sbjct: 136 EHTINGRRFALELHMVHEGRNRRMAVVTVLYKIGRADTFIRSLEKELEGIAEMEEAEKNV 195
Query: 191 GVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNT 250
G+IDP IKIGS KYYRY GSLT PPCT+NVTW++VRKVR+VTR+QV++LRVAVHD++N+
Sbjct: 196 GMIDPTKIKIGSRKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDDANS 255
Query: 251 NARPLQPINMRSVKLYKP 268
NARP+QP N R V LY+P
Sbjct: 256 NARPVQPTNKRIVHLYRP 273
|
|
| TAIR|locus:2827099 ACA5 "alpha carbonic anhydrase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84UV8 NEC3 "Bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3" [Nicotiana langsdorffii x Nicotiana sanderae (taxid:164110)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062819 ACA2 "alpha carbonic anhydrase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133119 ACA4 "alpha carbonic anhydrase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161043 ACA8 "alpha carbonic anhydrase 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133129 ACA6 "alpha carbonic anhydrase 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146723 ACA3 "alpha carbonic anhydrase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083213 ACA1 "alpha carbonic anhydrase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KMP6 VC_A0274 "Carbonic anhydrase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 275 | |||
| cd03124 | 216 | cd03124, alpha_CA_prokaryotic_like, Carbonic anhyd | 4e-96 | |
| PLN02179 | 235 | PLN02179, PLN02179, carbonic anhydrase | 2e-83 | |
| cd00326 | 227 | cd00326, alpha_CA, Carbonic anhydrase alpha (verte | 4e-69 | |
| smart01057 | 247 | smart01057, Carb_anhydrase, Eukaryotic-type carbon | 4e-67 | |
| PLN02202 | 284 | PLN02202, PLN02202, carbonate dehydratase | 6e-65 | |
| COG3338 | 250 | COG3338, Cah, Carbonic anhydrase [Inorganic ion tr | 6e-61 | |
| pfam00194 | 238 | pfam00194, Carb_anhydrase, Eukaryotic-type carboni | 4e-37 | |
| cd03117 | 234 | cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase a | 4e-34 | |
| cd03119 | 259 | cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydras | 2e-33 | |
| cd03123 | 248 | cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydras | 1e-31 | |
| cd03122 | 253 | cd03122, alpha_CARP_receptor_like, Carbonic anhydr | 2e-28 | |
| cd03125 | 249 | cd03125, alpha_CA_VI, Carbonic anhydrase alpha, is | 2e-27 | |
| cd03121 | 256 | cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase | 3e-27 | |
| cd03149 | 236 | cd03149, alpha_CA_VII, Carbonic anhydrase alpha, C | 1e-24 | |
| cd03126 | 249 | cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alph | 5e-23 | |
| cd03118 | 236 | cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA | 2e-22 | |
| cd03150 | 247 | cd03150, alpha_CA_IX, Carbonic anhydrase alpha, is | 5e-21 | |
| cd03120 | 256 | cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha | 4e-20 |
| >gnl|CDD|239398 cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily | Back alignment and domain information |
|---|
Score = 281 bits (720), Expect = 4e-96
Identities = 95/223 (42%), Positives = 141/223 (63%), Gaps = 8/223 (3%)
Query: 44 GPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPSNATLRNRGHDIML 103
GP+ WG + E++ C G QSPID+ + V V L L +YKP++ATL N GH I +
Sbjct: 1 GPEHWGNLDPEFALCATGKNQSPIDITTKAV-VSDKLPPLNYNYKPTSATLVNNGHTIQV 59
Query: 104 QWKGGAGTILINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESHDGKVAVVGIVYKI 163
++G GT+ I+G Y L Q H+HSPSEH I+GKR+ LEAH+VH+S DG++AVV ++++
Sbjct: 60 NFEGNGGTLTIDGETYQLLQFHFHSPSEHLINGKRYPLEAHLVHKSKDGQLAVVAVLFEE 119
Query: 164 GRPDSFLASISDHLRNISGSNERDATV-GVIDPRAIKIGSSKYYRYIGSLTVPPCTENVT 222
G+ + FL I L N+ + + ++DP + S YYRY GSLT PPC+E V
Sbjct: 120 GKENPFLKKI---LDNMPKKEGTEVNLPAILDPNELLPESRSYYRYEGSLTTPPCSEGVR 176
Query: 223 WTIVRKVRSVTREQVRVLRVAVHDESNTNARPLQPINMRSVKL 265
W ++++ ++++EQ+ R AV+ NARP+QP+N R V L
Sbjct: 177 WIVLKQPITISKEQLAKFRAAVY---PNNARPVQPLNGREVLL 216
|
Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This sub-family includes bacterial carbonic anhydrase alpha, as well as plant enzymes such as tobacco nectarin III and yam dioscorin and, carbonic anhydrases from molluscs, such as nacrein, which are part of the organic matrix layer in shells. Other members of this family may be involved in maintaining pH balance, in facilitating transport of carbon dioxide or carbonic acid, or in sensing carbon dioxide levels in the environment. Dioscorin is the major storage protein of yam tubers and may play a role as an antioxidant. Tobacco Nectarin may play a role in the maintenace of pH and oxidative balance in nectar. Mollusc nacrein may participate in calcium carbonate crystal formation of the nacreous layer. This subfamily also includes three alpha carbonic anhydrases from Chlamydomonas reinhardtii (CAH 1-3). CAHs1-2 are localized in the periplasmic space. CAH1 faciliates the movement of carbon dioxide across the plasma membrane when the medium is alkaline. CAH3 is localized to the thylakoid lumen and provides CO2 to Rubisco. Length = 216 |
| >gnl|CDD|177835 PLN02179, PLN02179, carbonic anhydrase | Back alignment and domain information |
|---|
| >gnl|CDD|238200 cd00326, alpha_CA, Carbonic anhydrase alpha (vertebrate-like) group | Back alignment and domain information |
|---|
| >gnl|CDD|215000 smart01057, Carb_anhydrase, Eukaryotic-type carbonic anhydrase | Back alignment and domain information |
|---|
| >gnl|CDD|177853 PLN02202, PLN02202, carbonate dehydratase | Back alignment and domain information |
|---|
| >gnl|CDD|225875 COG3338, Cah, Carbonic anhydrase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|201071 pfam00194, Carb_anhydrase, Eukaryotic-type carbonic anhydrase | Back alignment and domain information |
|---|
| >gnl|CDD|239391 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes | Back alignment and domain information |
|---|
| >gnl|CDD|239393 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydrase alpha, isozymes I, II, and III and XIII | Back alignment and domain information |
|---|
| >gnl|CDD|239397 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV | Back alignment and domain information |
|---|
| >gnl|CDD|239396 cd03122, alpha_CARP_receptor_like, Carbonic anhydrase alpha related protein, receptor_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239399 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, isozyme VI | Back alignment and domain information |
|---|
| >gnl|CDD|239395 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase alpha related protein: groups X, XI and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239402 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, CA isozyme VII_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|239400 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alpha, isozymes XII and XIV | Back alignment and domain information |
|---|
| >gnl|CDD|239392 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA isozyme V_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|239403 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, isozyme IX | Back alignment and domain information |
|---|
| >gnl|CDD|239394 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha related protein, group VIII | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| PLN02202 | 284 | carbonate dehydratase | 100.0 | |
| COG3338 | 250 | Cah Carbonic anhydrase [Inorganic ion transport an | 100.0 | |
| cd03121 | 256 | alpha_CARP_X_XI_like Carbonic anhydrase alpha rela | 100.0 | |
| cd03124 | 216 | alpha_CA_prokaryotic_like Carbonic anhydrase alpha | 100.0 | |
| cd03119 | 259 | alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, i | 100.0 | |
| PF00194 | 256 | Carb_anhydrase: Eukaryotic-type carbonic anhydrase | 100.0 | |
| cd03126 | 249 | alpha_CA_XII_XIV Carbonic anhydrase alpha, isozyme | 100.0 | |
| cd03125 | 249 | alpha_CA_VI Carbonic anhydrase alpha, isozyme VI. | 100.0 | |
| cd03122 | 253 | alpha_CARP_receptor_like Carbonic anhydrase alpha | 100.0 | |
| cd03150 | 247 | alpha_CA_IX Carbonic anhydrase alpha, isozyme IX. | 100.0 | |
| cd03123 | 248 | alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, i | 100.0 | |
| cd03149 | 236 | alpha_CA_VII Carbonic anhydrase alpha, CA isozyme | 100.0 | |
| cd03118 | 236 | alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_ | 100.0 | |
| cd03120 | 256 | alpha_CARP_VIII Carbonic anhydrase alpha related p | 100.0 | |
| KOG0382 | 262 | consensus Carbonic anhydrase [General function pre | 100.0 | |
| PLN02179 | 235 | carbonic anhydrase | 100.0 | |
| cd03117 | 234 | alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_I | 100.0 | |
| cd00326 | 227 | alpha_CA Carbonic anhydrase alpha (vertebrate-like | 100.0 |
| >PLN02202 carbonate dehydratase | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-75 Score=528.78 Aligned_cols=253 Identities=40% Similarity=0.776 Sum_probs=218.3
Q ss_pred HHHHHHHHhccccccccCCCCCcccCCCCCCCCCCccccCcCcccCCCCCCCCCceeeCCceeeecCCCCceecccCCcc
Q 038655 13 FFAVILLLSGSAMSKEVDEEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPSNA 92 (275)
Q Consensus 13 ~~~~~~~~~~~~~~~~~~~~~~w~Y~~~~~~gP~~W~~l~~~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~y~~~~~ 92 (275)
+++++|+|+.+...+ ++..+|+|+ +.+||++|+.++++|..|++|++||||||.+..+...+.+.+|.++|.....
T Consensus 11 ~~~~~~~~~~~~~~~--~~~~~w~Y~--~~~GP~~W~~l~~~~~~C~~G~~QSPIdI~~~~~~~~~~l~~l~~~~~~~~~ 86 (284)
T PLN02202 11 FFAIALICIAPADAQ--TEGVVFGYK--GKNGPNQWGHLNPHFTKCAVGKLQSPIDIQRRQIFYNHKLESIHRDYYFTNA 86 (284)
T ss_pred HHHHHHHHHHhhhcc--cCCCCcCCC--CCCChhhhhhcCcchhhccCCCccCCEeecCCccccCCCCCceeeeccCCce
Confidence 566666666552222 345689995 6789999999999999999999999999998776556778889988877778
Q ss_pred EEeecCceeEEEecCCCceEEEcCeEEEeeeeeecCCCCCccccccccceeeeeeecCCCceEEEEEEeeeCCCCchhHH
Q 038655 93 TLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGRPDSFLAS 172 (275)
Q Consensus 93 ~l~N~G~tv~v~~~~~~~~~~i~G~~Y~l~q~HFH~gSEHtidG~~~~~E~HiVh~~~~~~laVlav~~~~g~~n~~l~~ 172 (275)
++.|+||++++.+.++.+.+.++|.+|.|.||||||||||+|||++|||||||||++.+|++|||||||++|+.|++++.
T Consensus 87 ~l~N~Ghtv~v~~~~~~~~~~~~g~~Y~L~QfHFH~gSEH~idG~~yp~E~H~VH~~~~g~laVlgv~~~~g~~n~~l~~ 166 (284)
T PLN02202 87 TLVNHVCNVAMFFGEGAGDVIIDNKNYTLLQMHWHTPSEHHLHGVQYAAELHMVHQAKDGSFAVVASLFKIGTEEPFLSQ 166 (284)
T ss_pred EEEECCccEEEEEcCCCCeeEECCcEEEEEEEEecCCcccEECCeeCCeEEEEEEEcCCCCEEEEEEEEeccCCChHHHH
Confidence 99999999999996555688899999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhcccCC--CCc---eeeecccCCCCccCCCCceEEEeeeccCCCCccceEEEEeceecccCHHHHHHHHHhccCC
Q 038655 173 ISDHLRNISGS--NER---DATVGVIDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDE 247 (275)
Q Consensus 173 i~~~l~~i~~~--~~~---~~~~~~~~l~~L~~~~~~yy~Y~GSLTTPPC~E~V~WiV~~~pi~IS~~Ql~~fr~~~~~~ 247 (275)
|++.+..+... ++. ...+..|++..|+|...+||+|.||||||||+|+|+|+||++|++||.+||++||++.+..
T Consensus 167 i~~~l~~i~~~~~~~~~~~~~~~~~~~~~~llp~~~~yy~Y~GSLTTPPC~E~V~W~V~~~pi~IS~~Ql~~fr~~~~~~ 246 (284)
T PLN02202 167 MKDKLVKLKEERFKGNHTAQVEVGKIDTRHIERKTRKYFRYIGSLTTPPCSENVSWTILGKVRSMSKEQVELLRSPLDKS 246 (284)
T ss_pred HHHHHHHhhcccccCcccccccccccCHHHhCccccceEEEeccccCCCCCCceEEEEeCceEEcCHHHHHHHHHhhhcc
Confidence 99988877431 111 1223468888888888999999999999999999999999999999999999999987655
Q ss_pred CCCCCCCCCCCCCceEEEeCCC
Q 038655 248 SNTNARPLQPINMRSVKLYKPD 269 (275)
Q Consensus 248 ~~~N~Rp~Qpln~R~V~~~~~~ 269 (275)
+.+|+||+||||||.|+++.+.
T Consensus 247 l~~N~RpvQplngR~V~~~~~~ 268 (284)
T PLN02202 247 FKNNSRPCQPLNGRRVEMFHDH 268 (284)
T ss_pred cCCCCCCCCCCCCCEEEEecCe
Confidence 7899999999999999988753
|
|
| >COG3338 Cah Carbonic anhydrase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03121 alpha_CARP_X_XI_like Carbonic anhydrase alpha related protein: groups X, XI and related proteins | Back alignment and domain information |
|---|
| >cd03124 alpha_CA_prokaryotic_like Carbonic anhydrase alpha, prokaryotic-like subfamily | Back alignment and domain information |
|---|
| >cd03119 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, isozymes I, II, and III and XIII | Back alignment and domain information |
|---|
| >PF00194 Carb_anhydrase: Eukaryotic-type carbonic anhydrase; InterPro: IPR001148 Carbonic anhydrases (CA: 4 | Back alignment and domain information |
|---|
| >cd03126 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozymes XII and XIV | Back alignment and domain information |
|---|
| >cd03125 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI | Back alignment and domain information |
|---|
| >cd03122 alpha_CARP_receptor_like Carbonic anhydrase alpha related protein, receptor_like subfamily | Back alignment and domain information |
|---|
| >cd03150 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX | Back alignment and domain information |
|---|
| >cd03123 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV | Back alignment and domain information |
|---|
| >cd03149 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme VII_like subgroup | Back alignment and domain information |
|---|
| >cd03118 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_like subgroup | Back alignment and domain information |
|---|
| >cd03120 alpha_CARP_VIII Carbonic anhydrase alpha related protein, group VIII | Back alignment and domain information |
|---|
| >KOG0382 consensus Carbonic anhydrase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02179 carbonic anhydrase | Back alignment and domain information |
|---|
| >cd03117 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes | Back alignment and domain information |
|---|
| >cd00326 alpha_CA Carbonic anhydrase alpha (vertebrate-like) group | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 275 | ||||
| 1kop_A | 223 | Neisseria Gonorrhoeae Carbonic Anhydrase Length = 2 | 1e-35 | ||
| 2it4_A | 256 | X Ray Structure Of The Complex Between Carbonic Anh | 5e-22 | ||
| 1j9w_A | 260 | Solution Structure Of The Cai Michigan 1 Variant Le | 5e-22 | ||
| 1crm_A | 260 | Structure And Function Of Carbonic Anhydrases Lengt | 5e-22 | ||
| 2foy_A | 260 | Human Carbonic Anhydrase I Complexed With A Two-Pro | 6e-22 | ||
| 3uyq_A | 260 | Hca 3 Length = 260 | 9e-22 | ||
| 2hfw_A | 260 | Structural And Kinetic Analysis Of Proton Shuttle R | 1e-21 | ||
| 3ryv_B | 259 | Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamo | 1e-21 | ||
| 1hva_A | 260 | Engineering The Zinc Binding Site Of Human Carbonic | 2e-21 | ||
| 1cnb_A | 259 | Compensatory Plastic Effects In The Redesign Of Pro | 2e-21 | ||
| 3fe4_A | 278 | Crystal Structure Of Human Carbonic Anhydrase Vi Le | 2e-21 | ||
| 2nwy_A | 260 | Structural And Kinetic Effects Of Hydrophobic Mutat | 2e-21 | ||
| 4bcw_A | 257 | Carbonic Anhydrase Ix Mimic In Complex With (e)-2-( | 3e-21 | ||
| 3dbu_A | 260 | Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, | 3e-21 | ||
| 3v3j_A | 260 | Kinetic And Structural Studies Of Thermostabilized | 3e-21 | ||
| 1z97_A | 266 | Human Carbonic Anhydrase Iii: Structural And Kineti | 4e-21 | ||
| 3pjj_A | 259 | Synthetic Dimer Of Human Carbonic Anhydrase Ii Leng | 4e-21 | ||
| 3v3i_B | 260 | Kinetic And Structural Studies Of Thermostabilized | 4e-21 | ||
| 3v3f_A | 260 | Kinetic And Structural Studies Of Thermostabilized | 4e-21 | ||
| 2foq_A | 260 | Human Carbonic Anhydrase Ii Complexed With Two-Pron | 5e-21 | ||
| 3tvo_X | 258 | Human Carbonic Anhydrase Ii Proton Transfer Double | 5e-21 | ||
| 3mni_A | 260 | Human Carbonic Anhydrase Ii Mutant K170d Length = 2 | 5e-21 | ||
| 3tvn_X | 258 | Human Carbonic Anhydrase Ii Proton Transfer Mutant | 5e-21 | ||
| 3rg4_A | 260 | Crystal Structure Of The W5f Mutant Of Human Carbon | 5e-21 | ||
| 1ugd_A | 258 | Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu | 6e-21 | ||
| 4g0c_A | 257 | Neutron Structure Of Acetazolamide-Bound Human Carb | 7e-21 | ||
| 3rg3_A | 260 | Crystal Structure Of The W5e Mutant Of Human Carbon | 7e-21 | ||
| 3tmj_A | 258 | Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHY | 7e-21 | ||
| 3r16_A | 257 | Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thioph | 7e-21 | ||
| 1ugf_A | 258 | Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M | 7e-21 | ||
| 1g6v_A | 260 | Complex Of The Camelid Heavy-Chain Antibody Fragmen | 8e-21 | ||
| 3pyk_A | 260 | Human Carbonic Anhydrase Ii As Host For Pianostool | 8e-21 | ||
| 1ugc_A | 258 | Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) M | 8e-21 | ||
| 2nxr_A | 260 | Structural Effects Of Hydrophobic Mutations On The | 8e-21 | ||
| 1ugb_A | 258 | Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu | 8e-21 | ||
| 3rge_A | 260 | Crystal Structure Of The W5h Mutant Of Human Carbon | 8e-21 | ||
| 3m1k_A | 265 | Carbonic Anhydrase In Complex With Fragment Length | 8e-21 | ||
| 3mnh_A | 260 | Human Carbonic Anhydrase Ii Mutant K170a Length = 2 | 8e-21 | ||
| 3v3g_B | 260 | Kinetic And Structural Studies Of Thermostabilized | 8e-21 | ||
| 3mnk_A | 260 | Human Carbonic Anhydrase Ii Mutant K170h Length = 2 | 8e-21 | ||
| 1xpz_A | 258 | Structure Of Human Carbonic Anhydrase Ii With 4-[4- | 8e-21 | ||
| 1th9_A | 260 | Effect Of Shuttle Location And Ph Environment On H+ | 8e-21 | ||
| 3kkx_A | 260 | Neutron Structure Of Human Carbonic Anhydrase Ii Le | 8e-21 | ||
| 2pov_A | 259 | The Crystal Structure Of The Human Carbonic Anhydra | 8e-21 | ||
| 3mnj_A | 260 | Human Carbonic Anhydrase Ii Mutant K170e Length = 2 | 9e-21 | ||
| 1z93_A | 266 | Human Carbonic Anhydrase Iii:structural And Kinetic | 9e-21 | ||
| 3rld_A | 260 | Crystal Structure Of The Y7i Mutant Of Human Carbon | 9e-21 | ||
| 3uyn_A | 260 | Hca 3 Length = 260 | 9e-21 | ||
| 1lzv_A | 260 | Site-Specific Mutant (Tyr7 Replaced With His) Of Hu | 9e-21 | ||
| 2cbe_A | 260 | Structure Of Native And Apo Carbonic Anhydrase Ii A | 1e-20 | ||
| 1tg3_A | 260 | Effect Of Shuttle Location And Ph Environment On H+ | 1e-20 | ||
| 1f2w_A | 259 | The Mechanism Of Cyanamide Hydration Catalyzed By C | 1e-20 | ||
| 3v3h_B | 260 | Kinetic And Structural Studies Of Thermostabilized | 1e-20 | ||
| 1g3z_A | 259 | Carbonic Anhydrase Ii (F131v) Length = 259 | 1e-20 | ||
| 1uga_A | 258 | Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu | 1e-20 | ||
| 3dvc_A | 259 | X-Ray Crystal Structure Of Mutant N62t Of Human Car | 1e-20 | ||
| 1cnk_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 1e-20 | ||
| 3dv7_A | 259 | Role Of Hydrophilic Residues In Proton Transfer Dur | 1e-20 | ||
| 3dvd_A | 259 | X-Ray Crystal Structure Of Mutant N62d Of Human Car | 1e-20 | ||
| 2nwo_A | 260 | Structural And Kinetic Effect Of Hydrophobic Mutati | 1e-20 | ||
| 1zh9_A | 259 | Carbonic Anhydrase Ii In Complex With N-4-methyl-1- | 1e-20 | ||
| 3u3a_X | 260 | Structure Of Human Carbonic Anhydrase Ii V143i Leng | 1e-20 | ||
| 5ca2_A | 260 | Conformational Mobility Of His-64 In The Thr-200 (R | 1e-20 | ||
| 1uge_A | 258 | Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M | 1e-20 | ||
| 1lg5_A | 260 | Crystal Structure Analysis Of The Hca Ii Mutant T19 | 1e-20 | ||
| 1fr7_A | 260 | X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M | 1e-20 | ||
| 1cvc_A | 259 | Redesigning The Zinc Binding Site Of Human Carbonic | 2e-20 | ||
| 1h4n_A | 259 | H94n Carbonic Anhydrase Ii Complexed With Tris Leng | 2e-20 | ||
| 3dvb_A | 259 | X-Ray Crystal Structure Of Mutant N62v Human Carbon | 2e-20 | ||
| 1fql_A | 260 | X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARB | 2e-20 | ||
| 3u47_A | 260 | Human Carbonic Anhydrase Ii V143l Length = 260 | 2e-20 | ||
| 1fqm_A | 260 | X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V | 2e-20 | ||
| 1cvf_A | 259 | Structural Consequences Of Redesigning A Protein-Zi | 2e-20 | ||
| 1ydb_A | 259 | Structural Basis Of Inhibitor Affinity To Variants | 2e-20 | ||
| 1flj_A | 260 | Crystal Structure Of S-Glutathiolated Carbonic Anhy | 2e-20 | ||
| 3da2_A | 262 | X-Ray Structure Of Human Carbonic Anhydrase 13 In C | 2e-20 | ||
| 3czv_A | 264 | Crystal Structure Of The Human Carbonic Anhydrase X | 2e-20 | ||
| 1cak_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 2e-20 | ||
| 1zsa_A | 259 | Carbonic Anhydrase Ii Mutant E117q, Apo Form Length | 2e-20 | ||
| 1caj_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 2e-20 | ||
| 6ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 2e-20 | ||
| 3ml5_A | 269 | Crystal Structure Of The C183sC217S MUTANT OF HUMAN | 2e-20 | ||
| 1bic_A | 259 | Crystallographic Analysis Of Thr-200-> His Human Ca | 2e-20 | ||
| 3u45_X | 260 | Human Carbonic Anhydrase Ii V143a Length = 260 | 2e-20 | ||
| 12ca_A | 260 | Altering The Mouth Of A Hydrophobic Pocket. Structu | 2e-20 | ||
| 1cnh_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 2e-20 | ||
| 9ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 3e-20 | ||
| 1cva_A | 259 | Structural And Functional Importance Of A Conserved | 3e-20 | ||
| 1cal_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 3e-20 | ||
| 1dca_A | 260 | Structure Of An Engineered Metal Binding Site In Hu | 4e-20 | ||
| 1hed_A | 260 | Structural Consequences Of Hydrophilic Amino-Acid S | 4e-20 | ||
| 1ccs_A | 259 | Structure-Assisted Redesign Of A Protein-Zinc Bindi | 4e-20 | ||
| 1cct_A | 259 | Structure-Assisted Redesign Of A Protein-Zinc Bindi | 4e-20 | ||
| 1cnj_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 4e-20 | ||
| 1cai_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 4e-20 | ||
| 1cng_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 4e-20 | ||
| 1cvh_A | 255 | Structural Consequences Of Redesigning A Protein-Zi | 5e-20 | ||
| 1cni_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 5e-20 | ||
| 1h9q_A | 259 | H119q Carbonic Anhydrase Ii Length = 259 | 5e-20 | ||
| 1h9n_A | 259 | H119n Carbonic Anhydrase Ii Length = 259 | 5e-20 | ||
| 7ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 6e-20 | ||
| 1ccu_A | 259 | Structure-Assisted Redesign Of A Protein-Zinc Bindi | 6e-20 | ||
| 1hea_A | 260 | Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca | 6e-20 | ||
| 1heb_A | 260 | Structural Consequences Of Hydrophilic Amino-Acid S | 6e-20 | ||
| 1ydd_A | 259 | Structural Basis Of Inhibitor Affinity To Variants | 6e-20 | ||
| 3mdz_A | 281 | Crystal Structure Of Human Carbonic Anhydrase Vii [ | 6e-20 | ||
| 8ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 7e-20 | ||
| 1yda_A | 259 | Structural Basis Of Inhibitor Affinity To Variants | 7e-20 | ||
| 1hec_A | 260 | Structural Consequences Of Hydrophilic Amino-Acid S | 7e-20 | ||
| 1cve_A | 259 | Structural Consequences Of Redesigning A Protein-Zi | 7e-20 | ||
| 1mua_A | 256 | Structure And Energetics Of A Non-Proline Cis-Pepti | 9e-20 | ||
| 2fnm_A | 260 | Activation Of Human Carbonic Anhdyrase Ii By Exogen | 1e-19 | ||
| 1g0e_A | 260 | Site-Specific Mutant (His64 Replaced With Ala) Of H | 1e-19 | ||
| 2fnn_A | 260 | Activation Of Human Carbonic Anhydrase Ii By Exogen | 1e-19 | ||
| 2fnk_A | 260 | Activation Of Human Carbonic Anhydrase Ii By Exogen | 1e-19 | ||
| 3m1q_A | 265 | Carbonic Anhydrase Ii Mutant W5c-H64c With Opened D | 1e-19 | ||
| 1cvd_A | 255 | Structural Consequences Of Redesigning A Protein-Zi | 1e-19 | ||
| 3kig_A | 265 | Mutant Carbonic Anhydrase Ii In Complex With An Azi | 1e-19 | ||
| 3q31_A | 244 | Structure Of Fungal Alpha Carbonic Anhydrase From A | 2e-19 | ||
| 1yo0_A | 260 | Proton Transfer From His200 In Human Carbonic Anhyd | 2e-19 | ||
| 1znc_A | 266 | Human Carbonic Anhydrase Iv Length = 266 | 1e-18 | ||
| 1v9e_A | 259 | Crystal Structure Analysis Of Bovine Carbonic Anhyd | 1e-18 | ||
| 1jcz_A | 263 | Crystal Structure Of The Extracellular Domain Of Hu | 2e-18 | ||
| 1v9i_C | 261 | Crystal Structure Analysis Of The Site Specific Mut | 2e-18 | ||
| 1keq_A | 248 | Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V | 3e-17 | ||
| 2znc_A | 258 | Murine Carbonic Anhydrase Iv Length = 258 | 3e-17 | ||
| 1dmx_A | 248 | Murine Mitochondrial Carbonic Anyhdrase V At 2.45 A | 3e-17 | ||
| 1urt_A | 248 | Murine Carbonic Anhydrase V Length = 248 | 1e-16 | ||
| 1y7w_A | 291 | Crystal Structure Of A Halotolerant Carbonic Anhydr | 2e-15 | ||
| 3iai_A | 257 | Crystal Structure Of The Catalytic Domain Of The Tu | 4e-15 | ||
| 2w2j_A | 291 | Crystal Structure Of The Human Carbonic Anhydrase R | 9e-14 | ||
| 3jxf_A | 272 | Ca-Like Domain Of Human Ptprz Length = 272 | 1e-12 | ||
| 3s97_A | 273 | Ptprz Cntn1 Complex Length = 273 | 1e-12 | ||
| 3b1b_A | 377 | The Unique Structure Of Wild Type Carbonic Anhydras | 3e-12 | ||
| 3jxg_B | 269 | Ca-Like Domain Of Mouse Ptprg Length = 269 | 1e-11 | ||
| 1rj5_A | 261 | Crystal Structure Of The Extracellular Domain Of Mu | 3e-11 | ||
| 3jxh_C | 265 | Ca-Like Domain Of Human Ptprg Length = 265 | 6e-11 |
| >pdb|1KOP|A Chain A, Neisseria Gonorrhoeae Carbonic Anhydrase Length = 223 | Back alignment and structure |
|
| >pdb|2IT4|A Chain A, X Ray Structure Of The Complex Between Carbonic Anhydrase I And The Phosphonate Antiviral Drug Foscarnet Length = 256 | Back alignment and structure |
| >pdb|1J9W|A Chain A, Solution Structure Of The Cai Michigan 1 Variant Length = 260 | Back alignment and structure |
| >pdb|1CRM|A Chain A, Structure And Function Of Carbonic Anhydrases Length = 260 | Back alignment and structure |
| >pdb|2FOY|A Chain A, Human Carbonic Anhydrase I Complexed With A Two-Prong Inhibitor Length = 260 | Back alignment and structure |
| >pdb|3UYQ|A Chain A, Hca 3 Length = 260 | Back alignment and structure |
| >pdb|2HFW|A Chain A, Structural And Kinetic Analysis Of Proton Shuttle Residues In The Active Site Of Human Carbonic Anhydrase Iii Length = 260 | Back alignment and structure |
| >pdb|3RYV|B Chain B, Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamoylbenzamide Length = 259 | Back alignment and structure |
| >pdb|1HVA|A Chain A, Engineering The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of The His-94-> Cys Apoenzyme In A New Crystalline Form Length = 260 | Back alignment and structure |
| >pdb|1CNB|A Chain A, Compensatory Plastic Effects In The Redesign Of Protein- Zinc Binding Sites Length = 259 | Back alignment and structure |
| >pdb|3FE4|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vi Length = 278 | Back alignment and structure |
| >pdb|2NWY|A Chain A, Structural And Kinetic Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|4BCW|A Chain A, Carbonic Anhydrase Ix Mimic In Complex With (e)-2-(5-bromo- 2-hydroxyphenyl)ethenesulfonic Acid Length = 257 | Back alignment and structure |
| >pdb|3DBU|A Chain A, Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, For The Purpose Of Screening Inhibitors For Possible Anti-Cancer Properties Length = 260 | Back alignment and structure |
| >pdb|3V3J|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|1Z97|A Chain A, Human Carbonic Anhydrase Iii: Structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 | Back alignment and structure |
| >pdb|3PJJ|A Chain A, Synthetic Dimer Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|3V3I|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|3V3F|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|2FOQ|A Chain A, Human Carbonic Anhydrase Ii Complexed With Two-Prong Inhibitors Length = 260 | Back alignment and structure |
| >pdb|3TVO|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Double Mutant Length = 258 | Back alignment and structure |
| >pdb|3MNI|A Chain A, Human Carbonic Anhydrase Ii Mutant K170d Length = 260 | Back alignment and structure |
| >pdb|3TVN|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Mutant Length = 258 | Back alignment and structure |
| >pdb|3RG4|A Chain A, Crystal Structure Of The W5f Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1UGD|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Ser (A65s) Length = 258 | Back alignment and structure |
| >pdb|4G0C|A Chain A, Neutron Structure Of Acetazolamide-Bound Human Carbonic Anhydrase Ii Reveal Molecular Details Of Drug Binding Length = 257 | Back alignment and structure |
| >pdb|3RG3|A Chain A, Crystal Structure Of The W5e Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3TMJ|A Chain A, Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHYDRASE II AT PH 7.8 Length = 258 | Back alignment and structure |
| >pdb|3R16|A Chain A, Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thiophen-2-Yl) Acetamide Length = 257 | Back alignment and structure |
| >pdb|1UGF|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Thr (A65t) Length = 258 | Back alignment and structure |
| >pdb|1G6V|A Chain A, Complex Of The Camelid Heavy-Chain Antibody Fragment Cab- Ca05 With Bovine Carbonic Anhydrase Length = 260 | Back alignment and structure |
| >pdb|3PYK|A Chain A, Human Carbonic Anhydrase Ii As Host For Pianostool Complexes Bearing A Sulfonamide Anchor Length = 260 | Back alignment and structure |
| >pdb|1UGC|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) Mutant With Ala 65 Replaced By His (a65h) Length = 258 | Back alignment and structure |
| >pdb|2NXR|A Chain A, Structural Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1UGB|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Gly (A65g) Length = 258 | Back alignment and structure |
| >pdb|3RGE|A Chain A, Crystal Structure Of The W5h Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3M1K|A Chain A, Carbonic Anhydrase In Complex With Fragment Length = 265 | Back alignment and structure |
| >pdb|3MNH|A Chain A, Human Carbonic Anhydrase Ii Mutant K170a Length = 260 | Back alignment and structure |
| >pdb|3V3G|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|3MNK|A Chain A, Human Carbonic Anhydrase Ii Mutant K170h Length = 260 | Back alignment and structure |
| >pdb|1XPZ|A Chain A, Structure Of Human Carbonic Anhydrase Ii With 4-[4-O- Sulfamoylbenzyl)(4-Cyanophenyl)amino]-4h-[1,2, 4]-Triazole Length = 258 | Back alignment and structure |
| >pdb|1TH9|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3KKX|A Chain A, Neutron Structure Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|2POV|A Chain A, The Crystal Structure Of The Human Carbonic Anhydrase Ii In Complex With 4-Amino-6-Chloro-Benzene-1,3-Disulfonamide Length = 259 | Back alignment and structure |
| >pdb|3MNJ|A Chain A, Human Carbonic Anhydrase Ii Mutant K170e Length = 260 | Back alignment and structure |
| >pdb|1Z93|A Chain A, Human Carbonic Anhydrase Iii:structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 | Back alignment and structure |
| >pdb|3RLD|A Chain A, Crystal Structure Of The Y7i Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3UYN|A Chain A, Hca 3 Length = 260 | Back alignment and structure |
| >pdb|1LZV|A Chain A, Site-Specific Mutant (Tyr7 Replaced With His) Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|2CBE|A Chain A, Structure Of Native And Apo Carbonic Anhydrase Ii And Some Of Its Anion-Ligand Complexes Length = 260 | Back alignment and structure |
| >pdb|1TG3|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1F2W|A Chain A, The Mechanism Of Cyanamide Hydration Catalyzed By Carbonic Anhydrase Ii Revealed By Cryogenic X-Ray Diffraction Length = 259 | Back alignment and structure |
| >pdb|3V3H|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|1G3Z|A Chain A, Carbonic Anhydrase Ii (F131v) Length = 259 | Back alignment and structure |
| >pdb|1UGA|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Phe (A65f) Length = 258 | Back alignment and structure |
| >pdb|3DVC|A Chain A, X-Ray Crystal Structure Of Mutant N62t Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1CNK|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|3DV7|A Chain A, Role Of Hydrophilic Residues In Proton Transfer During Catalysis By Human Carbonic Anhydrase Ii (N62a) Length = 259 | Back alignment and structure |
| >pdb|3DVD|A Chain A, X-Ray Crystal Structure Of Mutant N62d Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|2NWO|A Chain A, Structural And Kinetic Effect Of Hydrophobic Mutations In The Active Site Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1ZH9|A Chain A, Carbonic Anhydrase Ii In Complex With N-4-methyl-1- Piperazinyl-n'-(p-sulfonamide)phenylthiourea As Sulfonamide Inhibitor Length = 259 | Back alignment and structure |
| >pdb|3U3A|X Chain X, Structure Of Human Carbonic Anhydrase Ii V143i Length = 260 | Back alignment and structure |
| >pdb|5CA2|A Chain A, Conformational Mobility Of His-64 In The Thr-200 (Right Arrow) Ser Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1UGE|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Leu (A65l) Length = 258 | Back alignment and structure |
| >pdb|1LG5|A Chain A, Crystal Structure Analysis Of The Hca Ii Mutant T199p In Complex With Beta-Mercaptoethanol Length = 260 | Back alignment and structure |
| >pdb|1FR7|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M Carbonic Anhydrase (Caii) Variant Length = 260 | Back alignment and structure |
| >pdb|1CVC|A Chain A, Redesigning The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of A His2asp-Zn2+ Metal Coordination Polyhedron Length = 259 | Back alignment and structure |
| >pdb|1H4N|A Chain A, H94n Carbonic Anhydrase Ii Complexed With Tris Length = 259 | Back alignment and structure |
| >pdb|3DVB|A Chain A, X-Ray Crystal Structure Of Mutant N62v Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1FQL|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARBONIC Anhydrase (Caii) Variant Length = 260 | Back alignment and structure |
| >pdb|3U47|A Chain A, Human Carbonic Anhydrase Ii V143l Length = 260 | Back alignment and structure |
| >pdb|1FQM|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V Carbonic Anhydrase (Caii) Variant Length = 260 | Back alignment and structure |
| >pdb|1CVF|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1YDB|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1FLJ|A Chain A, Crystal Structure Of S-Glutathiolated Carbonic Anhydrase Iii Length = 260 | Back alignment and structure |
| >pdb|3DA2|A Chain A, X-Ray Structure Of Human Carbonic Anhydrase 13 In Complex With Inhibitor Length = 262 | Back alignment and structure |
| >pdb|3CZV|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Xiii In Complex With Acetazolamide Length = 264 | Back alignment and structure |
| >pdb|1CAK|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1ZSA|A Chain A, Carbonic Anhydrase Ii Mutant E117q, Apo Form Length = 259 | Back alignment and structure |
| >pdb|1CAJ|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|6CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3ML5|A Chain A, Crystal Structure Of The C183sC217S MUTANT OF HUMAN CA VII IN COMPLEX With Acetazolamide Length = 269 | Back alignment and structure |
| >pdb|1BIC|A Chain A, Crystallographic Analysis Of Thr-200-> His Human Carbonic Anhydrase Ii And Its Complex With The Substrate, Hco3- Length = 259 | Back alignment and structure |
| >pdb|3U45|X Chain X, Human Carbonic Anhydrase Ii V143a Length = 260 | Back alignment and structure |
| >pdb|12CA|A Chain A, Altering The Mouth Of A Hydrophobic Pocket. Structure And Kinetics Of Human Carbonic Anhydrase Ii Mutants At Residue Val-121 Length = 260 | Back alignment and structure |
| >pdb|1CNH|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|9CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1CVA|A Chain A, Structural And Functional Importance Of A Conserved Hydrogen Bond Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1CAL|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1DCA|A Chain A, Structure Of An Engineered Metal Binding Site In Human Carbonic Anhydrase Ii Reveals The Architecture Of A Regulatory Cysteine Switch Length = 260 | Back alignment and structure |
| >pdb|1HED|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1CCS|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 | Back alignment and structure |
| >pdb|1CCT|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 | Back alignment and structure |
| >pdb|1CNJ|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1CAI|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1CNG|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1CVH|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 | Back alignment and structure |
| >pdb|1CNI|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1H9Q|A Chain A, H119q Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1H9N|A Chain A, H119n Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|7CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1CCU|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 | Back alignment and structure |
| >pdb|1HEA|A Chain A, Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca Ii) (E.C.4.2.1.1) Mutant With Leu 198 Replaced By Arg (L198r) Length = 260 | Back alignment and structure |
| >pdb|1HEB|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1YDD|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|3MDZ|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vii [isoform 1], Ca7 Length = 281 | Back alignment and structure |
| >pdb|8CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1YDA|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1HEC|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1CVE|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1MUA|A Chain A, Structure And Energetics Of A Non-Proline Cis-Peptidyl Linkage In An Engineered Protein Length = 256 | Back alignment and structure |
| >pdb|2FNM|A Chain A, Activation Of Human Carbonic Anhdyrase Ii By Exogenous Proton Donors Length = 260 | Back alignment and structure |
| >pdb|1G0E|A Chain A, Site-Specific Mutant (His64 Replaced With Ala) Of Human Carbonic Anhydrase Ii Complexed With 4-Methylimidazole Length = 260 | Back alignment and structure |
| >pdb|2FNN|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 | Back alignment and structure |
| >pdb|2FNK|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 | Back alignment and structure |
| >pdb|3M1Q|A Chain A, Carbonic Anhydrase Ii Mutant W5c-H64c With Opened Disulfide Bond Length = 265 | Back alignment and structure |
| >pdb|1CVD|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 | Back alignment and structure |
| >pdb|3KIG|A Chain A, Mutant Carbonic Anhydrase Ii In Complex With An Azide And An Alkyne Length = 265 | Back alignment and structure |
| >pdb|3Q31|A Chain A, Structure Of Fungal Alpha Carbonic Anhydrase From Aspergillus Oryzae Length = 244 | Back alignment and structure |
| >pdb|1YO0|A Chain A, Proton Transfer From His200 In Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1ZNC|A Chain A, Human Carbonic Anhydrase Iv Length = 266 | Back alignment and structure |
| >pdb|1V9E|A Chain A, Crystal Structure Analysis Of Bovine Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1JCZ|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Carbonic Anhydrase Xii Length = 263 | Back alignment and structure |
| >pdb|1V9I|C Chain C, Crystal Structure Analysis Of The Site Specific Mutant (Q253c) Of Bovine Carbonic Anhydrase Ii Length = 261 | Back alignment and structure |
| >pdb|1KEQ|A Chain A, Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V, Covalently Modified With 4-Chloromethylimidazole Length = 248 | Back alignment and structure |
| >pdb|2ZNC|A Chain A, Murine Carbonic Anhydrase Iv Length = 258 | Back alignment and structure |
| >pdb|1DMX|A Chain A, Murine Mitochondrial Carbonic Anyhdrase V At 2.45 Angstroms Resolution Length = 248 | Back alignment and structure |
| >pdb|1URT|A Chain A, Murine Carbonic Anhydrase V Length = 248 | Back alignment and structure |
| >pdb|1Y7W|A Chain A, Crystal Structure Of A Halotolerant Carbonic Anhydrase From Dunaliella Salina Length = 291 | Back alignment and structure |
| >pdb|3IAI|A Chain A, Crystal Structure Of The Catalytic Domain Of The Tumor-Associated Human Carbonic Anhydrase Ix Length = 257 | Back alignment and structure |
| >pdb|2W2J|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Related Protein Viii Length = 291 | Back alignment and structure |
| >pdb|3JXF|A Chain A, Ca-Like Domain Of Human Ptprz Length = 272 | Back alignment and structure |
| >pdb|3S97|A Chain A, Ptprz Cntn1 Complex Length = 273 | Back alignment and structure |
| >pdb|3B1B|A Chain A, The Unique Structure Of Wild Type Carbonic Anhydrase Alpha-Ca1 From Chlamydomonas Reinhardtii Length = 377 | Back alignment and structure |
| >pdb|1RJ5|A Chain A, Crystal Structure Of The Extracellular Domain Of Murine Carbonic Anhydrase Xiv Length = 261 | Back alignment and structure |
| >pdb|3JXH|C Chain C, Ca-Like Domain Of Human Ptprg Length = 265 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 275 | |||
| 1kop_A | 223 | Carbonic anhydrase; lyase, structural trimming; 1. | 3e-97 | |
| 3q31_A | 244 | Carbonic anhydrase; glysosy secreted, dimeric, lya | 2e-90 | |
| 3fe4_A | 278 | Carbonic anhydrase 6; secretion, metal binding, st | 9e-83 | |
| 3ml5_A | 269 | Carbonic anhydrase 7; protein-inhibitor complex, l | 4e-81 | |
| 3k34_A | 260 | Carbonic anhydrase 2; atomic resolution, sulfonami | 5e-81 | |
| 2foy_A | 260 | Carbonic anhydrase 1; lyase, zinc, inhibitor, copp | 2e-80 | |
| 3d0n_A | 264 | Carbonic anhydrase 13; lyase, metal-binding, metal | 6e-80 | |
| 2hfx_A | 260 | Carbonic anhydrase 3; proton shuttle, HCA III, pro | 2e-79 | |
| 3iai_A | 257 | Carbonic anhydrase 9; transmembrane proteins, cell | 6e-79 | |
| 3fw3_A | 266 | Carbonic anhydrase 4; structure-based drug design. | 1e-78 | |
| 1jd0_A | 263 | Carbonic anhydrase XII; extracellular domain, bito | 1e-77 | |
| 3b1b_A | 377 | Carbonic anhydrase 1; N-glycosylation, zinc-finger | 4e-77 | |
| 1keq_A | 248 | F65A/Y131C-MI carbonic anhydrase V; proton transfe | 7e-77 | |
| 2znc_A | 258 | Carbonic anhydrase IV; lyase, zinc, murine, membra | 4e-76 | |
| 2w2j_A | 291 | Carbonic anhydrase-related protein; lyase, metal-b | 7e-76 | |
| 1y7w_A | 291 | Halotolerant alpha-type carbonic anhydrase (DCA I; | 7e-75 | |
| 3jxf_A | 272 | Receptor-type tyrosine-protein phosphatase zeta; C | 1e-73 | |
| 1rj5_A | 261 | Carbonic anhydrase XIV; beta-sheet, alpha-helix, z | 8e-73 | |
| 3jxg_A | 269 | Receptor-type tyrosine-protein phosphatase gamma; | 4e-72 | |
| 4e9o_X | 269 | D8L antigen, IMV membrane protein; CAH alpha fold, | 2e-62 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 |
| >1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Length = 223 | Back alignment and structure |
|---|
Score = 283 bits (727), Expect = 3e-97
Identities = 77/230 (33%), Positives = 118/230 (51%), Gaps = 11/230 (4%)
Query: 34 EFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPSNAT 93
+ Y G P+ WG + E+ C G QSP+++ V L +K +YKPS
Sbjct: 3 HWGYT--GHDSPESWGNLSEEFRLCSTGKNQSPVNITET---VSGKLPAIKVNYKPSMVD 57
Query: 94 LRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESHDGK 153
+ N GH I + + G T+ +NG Y L+Q H+H PSE+ I G+ F +EAH VH + +
Sbjct: 58 VENNGHTIQVNYPEGGNTLTVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQ 117
Query: 154 VAVVGIVYKIGRPDSFLASISDHLRNISGSNERDATVGVIDPRAIKIGSSKYYRYIGSLT 213
V+ ++Y+ G+ + L+SI + + +G D + KYYR+ GSLT
Sbjct: 118 PLVLAVLYEAGKTNGRLSSIWNVMPMTAGK---VKLNQPFDASTLLPKRLKYYRFAGSLT 174
Query: 214 VPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNTNARPLQPINMRSV 263
PPCTE V+W +++ + + Q AV E N RP+QP+N R V
Sbjct: 175 TPPCTEGVSWLVLKTYDHIDQAQAEKFTRAVGSE---NNRPVQPLNARVV 221
|
| >3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Length = 244 | Back alignment and structure |
|---|
| >3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} PDB: 3mdz_A* Length = 269 | Back alignment and structure |
|---|
| >3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Length = 260 | Back alignment and structure |
|---|
| >2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Length = 260 | Back alignment and structure |
|---|
| >3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Length = 264 | Back alignment and structure |
|---|
| >3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} Length = 257 | Back alignment and structure |
|---|
| >3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} PDB: 1znc_A* 3f7b_A* 3f7u_A* Length = 266 | Back alignment and structure |
|---|
| >1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Length = 263 | Back alignment and structure |
|---|
| >3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Length = 377 | Back alignment and structure |
|---|
| >1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Length = 248 | Back alignment and structure |
|---|
| >2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Length = 258 | Back alignment and structure |
|---|
| >2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Length = 291 | Back alignment and structure |
|---|
| >3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} PDB: 3s97_A* Length = 272 | Back alignment and structure |
|---|
| >1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Length = 261 | Back alignment and structure |
|---|
| >4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Length = 269 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| 1kop_A | 223 | Carbonic anhydrase; lyase, structural trimming; 1. | 100.0 | |
| 3k34_A | 260 | Carbonic anhydrase 2; atomic resolution, sulfonami | 100.0 | |
| 3ml5_A | 269 | Carbonic anhydrase 7; protein-inhibitor complex, l | 100.0 | |
| 3q31_A | 244 | Carbonic anhydrase; glysosy secreted, dimeric, lya | 100.0 | |
| 2foy_A | 260 | Carbonic anhydrase 1; lyase, zinc, inhibitor, copp | 100.0 | |
| 1rj5_A | 261 | Carbonic anhydrase XIV; beta-sheet, alpha-helix, z | 100.0 | |
| 3d0n_A | 264 | Carbonic anhydrase 13; lyase, metal-binding, metal | 100.0 | |
| 2hfx_A | 260 | Carbonic anhydrase 3; proton shuttle, HCA III, pro | 100.0 | |
| 3iai_A | 257 | Carbonic anhydrase 9; transmembrane proteins, cell | 100.0 | |
| 1jd0_A | 263 | Carbonic anhydrase XII; extracellular domain, bito | 100.0 | |
| 3fw3_A | 266 | Carbonic anhydrase 4; structure-based drug design. | 100.0 | |
| 3jxg_A | 269 | Receptor-type tyrosine-protein phosphatase gamma; | 100.0 | |
| 3jxf_A | 272 | Receptor-type tyrosine-protein phosphatase zeta; C | 100.0 | |
| 2w2j_A | 291 | Carbonic anhydrase-related protein; lyase, metal-b | 100.0 | |
| 3b1b_A | 377 | Carbonic anhydrase 1; N-glycosylation, zinc-finger | 100.0 | |
| 3fe4_A | 278 | Carbonic anhydrase 6; secretion, metal binding, st | 100.0 | |
| 2znc_A | 258 | Carbonic anhydrase IV; lyase, zinc, murine, membra | 100.0 | |
| 1keq_A | 248 | F65A/Y131C-MI carbonic anhydrase V; proton transfe | 100.0 | |
| 1y7w_A | 291 | Halotolerant alpha-type carbonic anhydrase (DCA I; | 100.0 | |
| 4e9o_X | 269 | D8L antigen, IMV membrane protein; CAH alpha fold, | 100.0 |
| >1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-77 Score=524.46 Aligned_cols=221 Identities=33% Similarity=0.665 Sum_probs=203.3
Q ss_pred CCcccCCCCCCCCCCccccCcCcccCCCCCCCCCceeeCCceeeecCCCCceecccCCccEEeecCceeEEEecCCCceE
Q 038655 33 KEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTI 112 (275)
Q Consensus 33 ~~w~Y~~~~~~gP~~W~~l~~~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~y~~~~~~l~N~G~tv~v~~~~~~~~~ 112 (275)
.+|+|+ +..||++|+.++++|..|++|++||||||.+.. .+.+++|.++|.+..++|.|+||++++.++++.+.+
T Consensus 2 ~~w~Y~--~~~GP~~W~~l~p~~~~C~~G~~QSPInI~~~~---~~~l~~L~~~y~~~~~~l~N~Ghtv~v~~~~~~~~~ 76 (223)
T 1kop_A 2 THWGYT--GHDSPESWGNLSEEFRLCSTGKNQSPVNITETV---SGKLPAIKVNYKPSMVDVENNGHTIQVNYPEGGNTL 76 (223)
T ss_dssp CCCCSS--GGGSGGGHHHHCGGGTHHHHCSSCSCCEECCCB---CCCCCCEEEECCCBCCEEEECSSCEEEECSSCCCEE
T ss_pred CCcccC--CCCChhhhhhcCcchhhhcCCCccCCEEEccCC---CCCCCCeeeecCCCceEEEECCceeEEeecCCCCeE
Confidence 469996 568999999999999999889999999999854 567888999998888899999999999998765689
Q ss_pred EEcCeEEEeeeeeecCCCCCccccccccceeeeeeecCCCceEEEEEEeeeCCCCchhHHHHHHhhcccCCCCceeeecc
Q 038655 113 LINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDATVGV 192 (275)
Q Consensus 113 ~i~G~~Y~l~q~HFH~gSEHtidG~~~~~E~HiVh~~~~~~laVlav~~~~g~~n~~l~~i~~~l~~i~~~~~~~~~~~~ 192 (275)
.++|.+|+|.||||||||||+|||++|||||||||++.+|++|||||||++|+.|++|++|++.|+.+. ++...+..
T Consensus 77 ~~~g~~Y~l~Q~HfH~gSEHtidG~~~p~ElHlVH~n~~~~laVlgv~~~~g~~n~~l~~i~~~l~~i~---~~~~~~~~ 153 (223)
T 1kop_A 77 TVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQPLVLAVLYEAGKTNGRLSSIWNVMPMTA---GKVKLNQP 153 (223)
T ss_dssp EETTEEEEEEEEEEESSCSSEETTBCCSEEEEEEEECTTCCEEEEEEEEEECSCCSTTHHHHTTCCSSS---EEEECSSC
T ss_pred EECCeEEEEEEEEECCCcccccccccCcceeEEEeecCCCCeEEEEeeeecCCchhHHHHHHHHHHhcc---CceeecCc
Confidence 999999999999999999999999999999999999999999999999999999999999999998875 33445578
Q ss_pred cCCCCccCCCCceEEEeeeccCCCCccceEEEEeceecccCHHHHHHHHHhccCCCCCCCCCCCCCCCceEE
Q 038655 193 IDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNTNARPLQPINMRSVK 264 (275)
Q Consensus 193 ~~l~~L~~~~~~yy~Y~GSLTTPPC~E~V~WiV~~~pi~IS~~Ql~~fr~~~~~~~~~N~Rp~Qpln~R~V~ 264 (275)
|++.+|+|...+||+|.||||||||+|+|+|+||++|++||.+||++||+++.. +|+||+||||||.|+
T Consensus 154 ~~~~~Llp~~~~yy~Y~GSLTTPPC~E~V~W~V~~~pi~iS~~Ql~~fr~l~~~---~N~Rp~Qpln~R~V~ 222 (223)
T 1kop_A 154 FDASTLLPKRLKYYRFAGSLTTPPCTEGVSWLVLKTYDHIDQAQAEKFTRAVGS---ENNRPVQPLNARVVI 222 (223)
T ss_dssp BCGGGGSCSCCCEEEEEEECSSTTCCEEEEEEEESSCEEECHHHHHHHHHHHSS---CCCCCCCCCTTCCCB
T ss_pred cCHHHHCCCCCCeEEEeCcccCCCCCCCeeEEEeccccEeCHHHHHHHHHHccC---CCCCCCCcCCCCeEe
Confidence 999999998899999999999999999999999999999999999999998753 699999999999986
|
| >3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} SCOP: b.74.1.1 PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... | Back alignment and structure |
|---|
| >3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} SCOP: b.74.1.1 PDB: 3mdz_A* | Back alignment and structure |
|---|
| >3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A | Back alignment and structure |
|---|
| >1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* | Back alignment and structure |
|---|
| >3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* | Back alignment and structure |
|---|
| >3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} SCOP: b.74.1.0 | Back alignment and structure |
|---|
| >1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* | Back alignment and structure |
|---|
| >3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} SCOP: b.74.1.1 PDB: 1znc_A* 3f7b_A* 3f7u_A* | Back alignment and structure |
|---|
| >3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} SCOP: b.74.1.0 PDB: 3s97_A* | Back alignment and structure |
|---|
| >2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} | Back alignment and structure |
|---|
| >3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} SCOP: b.74.1.0 | Back alignment and structure |
|---|
| >2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* | Back alignment and structure |
|---|
| >1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A | Back alignment and structure |
|---|
| >1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} | Back alignment and structure |
|---|
| >4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 275 | ||||
| d1kopa_ | 223 | b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorr | 3e-67 | |
| d1flja_ | 259 | b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norv | 4e-62 | |
| d1hcba_ | 258 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 4e-61 | |
| d1luga_ | 259 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 1e-60 | |
| d1znca_ | 262 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 3e-58 | |
| d1rj6a_ | 259 | b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu | 2e-57 | |
| d1jd0a_ | 260 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 2e-57 | |
| d2znca_ | 258 | b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu | 2e-56 | |
| d1keqa_ | 238 | b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu | 6e-53 |
| >d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Length = 223 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Carbonic anhydrase superfamily: Carbonic anhydrase family: Carbonic anhydrase domain: Carbonic anhydrase species: Neisseria gonorrhoeae [TaxId: 485]
Score = 206 bits (524), Expect = 3e-67
Identities = 77/229 (33%), Positives = 120/229 (52%), Gaps = 11/229 (4%)
Query: 35 FNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPSNATL 94
+ Y G P+ WG + E+ C G QSP+++ V L +K +YKPS +
Sbjct: 4 WGYT--GHDSPESWGNLSEEFRLCSTGKNQSPVNITET---VSGKLPAIKVNYKPSMVDV 58
Query: 95 RNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESHDGKV 154
N GH I + + G T+ +NG Y L+Q H+H PSE+ I G+ F +EAH VH + +
Sbjct: 59 ENNGHTIQVNYPEGGNTLTVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQP 118
Query: 155 AVVGIVYKIGRPDSFLASISDHLRNISGSNERDATVGVIDPRAIKIGSSKYYRYIGSLTV 214
V+ ++Y+ G+ + L+SI + + +G + + D + KYYR+ GSLT
Sbjct: 119 LVLAVLYEAGKTNGRLSSIWNVMPMTAGKVKLNQP---FDASTLLPKRLKYYRFAGSLTT 175
Query: 215 PPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNTNARPLQPINMRSV 263
PPCTE V+W +++ + + Q AV E N RP+QP+N R V
Sbjct: 176 PPCTEGVSWLVLKTYDHIDQAQAEKFTRAVGSE---NNRPVQPLNARVV 221
|
| >d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Length = 259 | Back information, alignment and structure |
|---|
| >d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Length = 259 | Back information, alignment and structure |
|---|
| >d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Length = 259 | Back information, alignment and structure |
|---|
| >d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Length = 260 | Back information, alignment and structure |
|---|
| >d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Length = 238 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| d1kopa_ | 223 | Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: | 100.0 | |
| d1flja_ | 259 | Carbonic anhydrase {Rat (Rattus norvegicus), isozy | 100.0 | |
| d1hcba_ | 258 | Carbonic anhydrase {Human (Homo sapiens), erythroc | 100.0 | |
| d1luga_ | 259 | Carbonic anhydrase {Human (Homo sapiens), erythroc | 100.0 | |
| d1rj6a_ | 259 | Carbonic anhydrase {Mouse (Mus musculus), isozyme | 100.0 | |
| d1jd0a_ | 260 | Carbonic anhydrase {Human (Homo sapiens), isozyme | 100.0 | |
| d1znca_ | 262 | Carbonic anhydrase {Human (Homo sapiens), isozyme | 100.0 | |
| d2znca_ | 258 | Carbonic anhydrase {Mouse (Mus musculus), isozyme | 100.0 | |
| d1keqa_ | 238 | Carbonic anhydrase {Mouse (Mus musculus), liver, i | 100.0 |
| >d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Carbonic anhydrase superfamily: Carbonic anhydrase family: Carbonic anhydrase domain: Carbonic anhydrase species: Neisseria gonorrhoeae [TaxId: 485]
Probab=100.00 E-value=9.6e-71 Score=482.58 Aligned_cols=221 Identities=33% Similarity=0.665 Sum_probs=199.4
Q ss_pred CCcccCCCCCCCCCCccccCcCcccCCCCCCCCCceeeCCceeeecCCCCceecccCCccEEeecCceeEEEecCCCceE
Q 038655 33 KEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPSNATLRNRGHDIMLQWKGGAGTI 112 (275)
Q Consensus 33 ~~w~Y~~~~~~gP~~W~~l~~~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~y~~~~~~l~N~G~tv~v~~~~~~~~~ 112 (275)
.+|+|+ +.+||++|+.++++|..|++|++||||||.+..+ ..+.+|.++|.+..++|.|+||++++.+.++.+.+
T Consensus 2 ~~w~Y~--~~~GP~~W~~l~~~~~~C~~G~~QSPInI~~~~~---~~~~~l~~~~~~~~~~l~N~G~ti~~~~~~~~~~~ 76 (223)
T d1kopa_ 2 THWGYT--GHDSPESWGNLSEEFRLCSTGKNQSPVNITETVS---GKLPAIKVNYKPSMVDVENNGHTIQVNYPEGGNTL 76 (223)
T ss_dssp CCCCSS--GGGSGGGHHHHCGGGTHHHHCSSCSCCEECCCBC---CCCCCEEEECCCBCCEEEECSSCEEEECSSCCCEE
T ss_pred CccccC--CCCChhhhcccCccchhccCCCcCCCEeECcccc---ccCCceEEeccCceEEEEECCcEEEEEecCCcceE
Confidence 579996 6789999999999999999999999999987643 34567888888888999999999999988777789
Q ss_pred EEcCeEEEeeeeeecCCCCCccccccccceeeeeeecCCCceEEEEEEeeeCCCCchhHHHHHHhhcccCCCCceeeecc
Q 038655 113 LINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESHDGKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDATVGV 192 (275)
Q Consensus 113 ~i~G~~Y~l~q~HFH~gSEHtidG~~~~~E~HiVh~~~~~~laVlav~~~~g~~n~~l~~i~~~l~~i~~~~~~~~~~~~ 192 (275)
.++|..|+|.||||||||||+|||++|||||||||++.+++++|||||++.|+.|+.++.+++.|+.+. ++......
T Consensus 77 ~~~g~~Y~l~q~hfH~pSEH~i~g~~~~~E~hlvh~~~~~~~~vv~v~~~~~~~n~~~~~~~~~l~~~~---~~~~~~~~ 153 (223)
T d1kopa_ 77 TVNGRTYTLKQFHFHVPSENQIKGRTFPMEAHFVHLDENKQPLVLAVLYEAGKTNGRLSSIWNVMPMTA---GKVKLNQP 153 (223)
T ss_dssp EETTEEEEEEEEEEESSCSSEETTBCCSEEEEEEEECTTCCEEEEEEEEEECSCCSTTHHHHTTCCSSS---EEEECSSC
T ss_pred eecCceeEEEEEEECCCCcceECCEEcCcceEEEEeccCCccEEEEEEEeccCccHHHHHHHHhhhhcc---ccccccCC
Confidence 999999999999999999999999999999999999999999999999999999999999988776543 23333467
Q ss_pred cCCCCccCCCCceEEEeeeccCCCCccceEEEEeceecccCHHHHHHHHHhccCCCCCCCCCCCCCCCceEE
Q 038655 193 IDPRAIKIGSSKYYRYIGSLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNTNARPLQPINMRSVK 264 (275)
Q Consensus 193 ~~l~~L~~~~~~yy~Y~GSLTTPPC~E~V~WiV~~~pi~IS~~Ql~~fr~~~~~~~~~N~Rp~Qpln~R~V~ 264 (275)
|++..|+|...+||+|.||||||||+|+|+|+||++|+.||++||++||+++. .+|+||+||||||.|+
T Consensus 154 ~~l~~llp~~~~yy~Y~GSLTtPPC~E~V~WiV~~~~~~Is~~Ql~~~~~~~~---~~N~Rp~Q~ln~R~V~ 222 (223)
T d1kopa_ 154 FDASTLLPKRLKYYRFAGSLTTPPCTEGVSWLVLKTYDHIDQAQAEKFTRAVG---SENNRPVQPLNARVVI 222 (223)
T ss_dssp BCGGGGSCSCCCEEEEEEECSSTTCCEEEEEEEESSCEEECHHHHHHHHHHHS---SCCCCCCCCCTTCCCB
T ss_pred cCHHHhCCCCCCeEEEeceecCCCCcccEEEEEeCeEeecCHHHHHHHHHhcc---CCCCCCCCCCCCCEec
Confidence 89999999989999999999999999999999999999999999999999874 3699999999999985
|
| >d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} | Back information, alignment and structure |
|---|