Citrus Sinensis ID: 038658


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-
DWEGVLSCNIWDLPEERCDIIPALRVSYYYLSAPLKQCFAYCSLFPKDYEFEEEEIILLWSAVGFLDHRKSENPCEDLGRKFFQELRARSFFQQSSNNKSLFVMHDLINDLAHWAAGEIYFTMDYTSEVNKQQSFSKNLRHLSCICGKYDGVKRFEDLYNIQHLRTFLPVCLSNSSQGFLAHSILPKLFKLQRLRVFSLCGYWISELPDSIGDLRYLRYLNLSGTQIRTLPESVNKLYNLHTLSLEGCRGLRKLCAGMGNLIKLHHLNNSNTDSLEEMPLGIGKLTCLQTLCNFVVGKDSGSRLRELKLLTHLRGTLTISKLENAQLDGKKNLKVLMLRWTNSTDGSSLREAETQKGVLDMLKPHKNLEQFFISGYGGTKFPIWLGDSSFSNLVTLKFEDCGMCTTLPSVGQLPSLKHLAVRRMSRVRRLGSEFYGNDTPIPFPCLETLRFENLLEWEDWIPHGSTQGVEGFPKLRELEVIGCSKLKGTFPEHLPALEMLVIGGCEELLVSITSLPALSKLEIGGCKKVVWRSETDHLGSQNSVVCRDTLNQVLLAGPLKPRLPKLEELEISNIKNETYIWKRHNGFLQDISSLKRLTIGWCPTLQSLVAEEEKDQQQLCELSCRLEYLLLNDCKGLVKLPQSLLSLSSLREIEIYNCSSFVSFPEVALPSKVRSISIHRCDALKSLPEAWMCDANLSLEILTISRCHSLTYIAEVQLPPSLKNVVIRNCDNVRTLTVEEGIQSSSSRRYTSSLLEHLHIESCPSLTCIFSKNELLATLESLEVGNLPPSLKSLEVLSCSKLESIAERLDNNTSLETITIISCKNLKNLPT
cHHHHHcccccccccccccccHHHHccccccccccccccccccccccccCCcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEcHHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEECcccccccccccccccccccEEccccccccccccHHHHHHHHHcccccEEEEEccccccccccccccccccccEEEccccccccccccHHccccccEEEccccccccccHHHHcccccccEEEEccccccccccccccccccccccccEECcccccccHHHHccccccccEEEEccccccccccccccccEEEEECccccccccHHccHHHHHHcccccccccccEEEECcccccccccccccccccCEEEEECcccccccccccccccccccEEEccccccEECcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEEcccccEEEccccccccccEEEEcccccccccccccccccccccEEEECcccccccccccccccccccccccEEEECcccccccccHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccEEEECcccccCCcccccccccccEEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEECccccccccccccccccccccccccccccEEEECcccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEccccccccccc
DWEGVLSCNIWDLPEERCDIIPALRVSYYYLSAPLKQCFAYCSLFPKDYEFEEEEIILLWSAVGFLDHRKSENPCEDLGRKFFQELRARSFFQQSSNNKSLFVMHDLINDLAHWAAGEIYFTMDYTSEVNKQQSFSKNLRHLSCICGKYDGVKRFEDLYNIQHLRTFLPVCLSNSSQGFLAHSILPKLFKLQRLRVFSLCGYWISELPDSIGDLRYLRYLNLSGTQIRTLPESVNKLYNLHTLSLEGCRGLRKLCAGMGNLIKLHHLNNSNTDSLEEMPLGIGKLTCLQTLCNFVVGKDSGSRLRELKLLTHLRGTLTISKLENAQLDGKKNLKVLMLRWTNSTDG******ETQKGVLDMLKPHKNLEQFFISGYGGTKFPIWLGDSSFSNLVTLKFEDCGMCTTLPSVGQLPSLKHLAVRRMSRVRRLGSEFYGNDTPIPFPCLETLRFENLLEWEDWIPHGSTQGVEGFPKLRELEVIGCSKLKGTFPEHLPALEMLVIGGCEELLVSITSLPALSKLEIGGCKKVVWRSETDHLGSQNSVVCRDTLNQVLLAGPLKPRLPKLEELEISNIKNETYIWKRHNGFLQDISSLKRLTIGWCPTLQSLVAEEEKDQQQLCELSCRLEYLLLNDCKGLVKLPQSLLSLSSLREIEIYNCSSFVSFPEVALPSKVRSISIHRCDALKSLPEAWMCDANLSLEILTISRCHSLTYIAEVQLPPSLKNVVIRNCDNVRTLTVEEGI*******YTSSLLEHLHIESCPSLTCIFSKNELLATLESLEVGNLPPSLKSLEVLSCSKLESIAERLDNNTSLETITIISCKNLKNLPT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DWEGVLSCNIWDLPEERCDIIPALRVSYYYLSAPLKQCFAYCSLFPKDYEFEEEEIILLWSAVGFLDHRKSENPCEDLGRKFFQELRARSFFQQSSNNKSLFVMHDLINDLAHWAAGEIYFTMDYTSEVNKQQSFSKNLRHLSCICGKYDGVKRFEDLYNIQHLRTFLPVCLSNSSQGFLAHSILPKLFKLQRLRVFSLCGYWISELPDSIGDLRYLRYLNLSGTQIRTLPESVNKLYNLHTLSLEGCRGLRKLCAGMGNLIKLHHLNNSNTDSLEEMPLGIGKLTCLQTLCNFVVGKDSGSRLRELKLLTHLRGTLTISKLENAQLDGKKNLKVLMLRWTNSTDGSSLREAETQKGVLDMLKPHKNLEQFFISGYGGTKFPIWLGDSSFSNLVTLKFEDCGMCTTLPSVGQLPSLKHLAVRRMSRVRRLGSEFYGNDTPIPFPCLETLRFENLLEWEDWIPHGSTQGVEGFPKLRELEVIGCSKLKGTFPEHLPALEMLVIGGCEELLVSITSLPALSKLEIGGCKKVVWRSETDHLGSQNSVVCRDTLNQVLLAGPLKPRLPKLEELEISNIKNETYIWKRHNGFLQDISSLKRLTIGWCPTLQSLVAEEEKDQQQLCELSCRLEYLLLNDCKGLVKLPQSLLSLSSLREIEIYNCSSFVSFPEVALPSKVRSISIHRCDALKSLPEAWMCDANLSLEILTISRCHSLTYIAEVQLPPSLKNVVIRNCDNVRTLTVEEGIQSSSSRRYTSSLLEHLHIESCPSLTCIFSKNELLATLESLEVGNLPPSLKSLEVLSCSKLESIAERLDNNTSLETITIISCKNLKNLPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 190-288,325-345,358-431,467-492
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 161-291,337-345,358-433
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 225-310,359-432,468-496,513-535,555-731
View the alignment between query and template
View the model in PyMOL
Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 363-527
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 201-346,358-532,557-771,783-831
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:very confident
Coverage over the Query: 135-298,320-534,558-708
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:confident
Coverage over the Query: 17-121
View the alignment between query and template
View the model in PyMOL