Citrus Sinensis ID: 038679


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MKVRSSVKKLCQFCKIVKRRGHIFVICSANPKHKQRQGMSTFPNEGLLTSTFIETNVKQEIVPNHNFQVGLASLMPEKDETSSSIIYDGGPVLHLLFNQEN
cccccHHHHcccccEEEEEccEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccEEEEcccccc
***RSSVKKLCQFCKIVKRRGHIFVICSANP*******MSTFPN************************VGLASL******TSSSIIYDGGPVLHLLFNQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVRSSVKKLCQFCKIVKRRGHIFVICSANPKHKQRQGMSTFPNEGLLTSTFIETNVKQEIVPNHNFQVGLASLMPEKDETSSSIIYDGGPVLHLLFNQEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L36 probableQ035A6
50S ribosomal protein L36 2 probableB2K516
50S ribosomal protein L36 1 probableB1IQ00

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain 6
Confidence level:very confident
Coverage over the Query: 1-38
View the alignment between query and template
View the model in PyMOL