Citrus Sinensis ID: 038705

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-

MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLENVKDASEAKEAQLIEKRNLLRLLLEWTSSTSDDPMEHENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDVSD

ccHHHHHHHHHHHHcccccCCccccccEEEcHHHHHHHHHHHHcccEEcccEEcccccccccccEEEEEEEEcccccccccccccccccccEEEccccccccccccHHHHHHHHHHcccccEEEEEccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccHHHHHcccccccccEEECccccccccccccccccccccccccEEEcccccccHHHcccccccccEEEEEcccccccHHHHHHHccccccccccEEEEEcccccccccccHHHHccccccccccccccEEEEECccccccccccccccccEEEEEEEccccccccccccccccccEEEccccccEEECcccccccccccccccccEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEccccccccccccccccccccHHHHHHHHccccccccccccccEEEECcccccccccccccccccccEEEEEcccccccccccccccccccccEEEECcccccCCccccccccccccEEEEEcccccccccccccccccccEEEEccccccccHHccccccccccEEEEEcccccccccccccccccccEEEECccccccccccccccccccEEEEEEEccccccccccccccccccEEEECccccccccccccccccccEEEEEcccccccccccccccccccccEEEEECcccccCCccccccccccccccEEEEEcccccccccccccccccccEEEECccccccccccccccccccEEEECccHHHHHHHcccccccccccccccEEEEccEEEEEccc

MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDISKLENVKDASEAKEAQLIEKRNLLRLLLEWTSSTSD****HENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDV**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEDLGRKFFRDLHAKSFFQQSSCDTSRFVMHHLINDLAQWAAGDIYFRMGDVLEDHKRHRFSENLRHFSYLRGGYDGLKMFEVLSDAKRLRTFLPLVLSNTWSGKAYLAHSVLYMLFKLQRLRVLSLRGYSIFHVPSSIGDLKHLQYLDLSETKIKTLPESVNKLWNLHTLLLENCHRLKKLCANMGSLIKLHHLKNSNVKALEEMPKGIGNLTHLLTLSRFVVGKDVGSGLRTLKLLKHLQGTLDxxxxxxxxxxxxxxxxxxxxxRNLLRLLLEWTSSTSDDPMEHENVTLMLDGLKPHRNLEELTIRGYGGTTFPTWMGDSSFANLVLLRFEGCHRCTSLPSVGQLPLLKHLFIIEMTSVKMVGSEFYGNHCSVPFPSLETLCFQDIQEWEGWIPHGSGKEVNVFPQLRELSLIGCPKLQGRLPECLSSLERLVVRGCEQLTVLVSSLPKLCKLEIGGCKGMAWRSTNDVNRCCPQLLWLIAEEEQDQQQPVFPCSLQYLELSQCRYLVKLPQALLSLGFLREMEIYGNLIKEESIQSSSTRYTSLLEYLYIDDCASLTSLLPKNELPATLEHLHVKSCGNLAFLSLVGNLPKALKYLSVDHCLKLKSLAERLDNNSSLEAVKISYCENLIVLPDGLLKLNHLQEIFISHCPNLISFPDGGFLSSTLTKLWIYECEKLKALPNGMHNLTSLQELEIGDLPSMVYFPEDGFPTNLHSLEIRDMKMWKSLIEWEPLNRFTSLRRLSIHGCQDMVSFPQDNIGMMLPASLTKLEIVRFSNLEYLSSVGESLPSLECLILDDCPKLRYFPDKGLPPSLLQLHISNCPLIEESCRKDGGQYWHLISDIPCVYINFRCVFDVSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 118-216,296-366,398-433,498-532
View the alignment between query and template
View the model in PyMOL

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 498-568,591-751
View the alignment between query and template
View the model in PyMOL

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 143-177,189-222,277-285,299-431,499-703
View the alignment between query and template
View the model in PyMOL

Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 145-226,256-268,296-434,492-548,580-655,674-730
View the alignment between query and template
View the model in PyMOL

Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 88-223
View the alignment between query and template
View the model in PyMOL

Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 110-211,300-429,444-476,489-568,588-758
View the alignment between query and template
View the model in PyMOL

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 59-232,265-279,290-429,447-452,499-568,590-730
View the alignment between query and template
View the model in PyMOL

Template: 3VQ2, chain A
Confidence level:very confident
Coverage over the Query: 499-759,787-829
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 38-234,264-283,294-450,493-572,597-836
View the alignment between query and template
View the model in PyMOL

Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 82-222,249-473,494-559
View the alignment between query and template
View the model in PyMOL

Template: 2A5Y, chain B
Confidence level:probable
Coverage over the Query: 1-47
View the alignment between query and template
View the model in PyMOL

Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 116-307,328-480,501-673
View the alignment between query and template
View the model in PyMOL